The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV
QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
M4M2H6 Mel l 1.0101 284 1717 398.0 2.1e-112
AAC48288 Hom a 1.0102 284 1638 380.0 5.5e-107
AAX37288 Pen m 1 284 1637 379.7 6.4e-107
11893851 Pen a 1 284 1637 379.7 6.4e-107
EU410072 Lit v 1.0101 284 1637 379.7 6.4e-107
M1H607 Por p 1.0101 284 1631 378.4 1.7e-106
D3XNR9 Mac r 1.0101 284 1627 377.4 3.1e-106
CBY17558 Pan b 1.0101 284 1625 377.0 4.3e-106
C0LU07 Pro c 1.0101 284 1622 376.3 6.9e-106
O44119 Hom a 1.0101 284 1599 371.1 2.6e-104
A7L5V2 Scy p 1.0101 284 1583 367.4 3.3e-103
O61379 Pan s 1 274 1580 366.7 5e-103
Q25456 Met e 1 274 1576 365.8 9.4e-103
Q9N2R3 Cha f 1 264 1449 336.9 4.7e-94
BAA04557 Der f 10.0101 299 1426 331.6 2.1e-92
AAF72534 Bla g 7.0101 284 1424 331.2 2.7e-92
AAD19606 Per a 7.0102 284 1422 330.7 3.6e-92
AEX31649 Cho a 10.0101 284 1422 330.7 3.6e-92
NP_001103782 Bomb m 3.0101 285 1419 330.0 5.9e-92
Q9UB83 Per a 7 284 1418 329.8 6.9e-92
ABU97466 Blo t 10.0101 284 1409 327.8 2.8e-91
Q9NFZ4 Lep d 10 284 1403 326.4 7.3e-91
O18416 Der p 10 284 1400 325.7 1.2e-90
Q17H75 Aed a 10.0101 285 1397 325.0 1.9e-90
AAT40866 Tyr p 10.0101 284 1386 322.5 1.1e-89
CAA09938 Chi k 10 285 1352 314.8 2.3e-87
ACN32322 Asc l 3.0101 287 1279 298.1 2.4e-82
Q9NAS5 Ani s 3 284 1278 297.9 2.8e-82
AGM32377.1 Copt f 7.0101 256 1262 294.3 3e-81
CAC84590 Lep s 1 284 1193 278.5 1.9e-76
CAB38044 Hel as 1 284 1152 269.2 1.2e-73
Q17H80 Aed a 10.0201 284 1137 265.8 1.3e-72
APG42675 Hal l 1.0101 284 1130 264.2 4e-72
AAG08987 Hal d 1 284 1113 260.3 5.8e-71
AVD53650 Sac g 1.0101 284 1087 254.4 3.5e-69
AAG08989 Mim n 1 284 1025 240.2 6.4e-65
AAG08988 Per v 1 284 1012 237.3 5e-64
XP_026775428 Pan h 4.0201 284 1001 234.8 2.8e-63
NP_001117128 Sal s 4.0101 284 995 233.4 7.3e-63
AAK96889 Cra g 1 233 933 219.3 1e-58
XP_026781482 Pan h 4.0101 284 913 214.7 3.1e-57
AAK39511 Der f 11.0101 692 232 59.3 4.6e-10
AAM83103 Blo t 11 875 202 52.4 6.7e-08
AAO73464 Der p 11 875 191 49.9 3.8e-07
AAF72796 Ani s 2 869 189 49.5 5.2e-07
QPB41107 Rap v 2.0101 859 187 49.0 7.1e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 398.0 bits 1717,  Expect = 2e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 2. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 380.0 bits 1638,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL ANT   EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 3. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL AN   VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 4. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL AN   VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 5. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL AN   VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 6. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 378.4 bits 1631,  Expect = 2e-106
 Identities = 269/284 94%, Positives = 277/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKD+AMDRADTLEQQNKEANIRAEKAE++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL ANT   EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 7. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 377.4 bits 1627,  Expect = 3e-106
 Identities = 269/284 94%, Positives = 277/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEALL AN +  EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 377.0 bits 1625,  Expect = 4e-106
 Identities = 271/284 95%, Positives = 276/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V  LQKKLQQLEND+D V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEALL AN +  EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 376.3 bits 1622,  Expect = 7e-106
 Identities = 267/284 94%, Positives = 277/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQA KLEKDNAMDRADTLEQQNKEANIRAEKAE++V+ LQK++Q+LEND+DQV
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL ANT   EKDKA+SNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 10. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 371.1 bits 1599,  Expect = 3e-104
 Identities = 264/284 92%, Positives = 273/284 96%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEK E+++   +KK+QQ+EN++DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L LANT   EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 367.4 bits 1583,  Expect = 3e-103
 Identities = 260/284 91%, Positives = 270/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK E+++   QKK+QQ+EN++DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT   EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 366.7 bits 1580,  Expect = 5e-103
 Identities = 261/274 95%, Positives = 268/274 97%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANTN 70
            MKLEKDNAMDRADTLEQQNKEANIRAEKAE++V+ LQK++QQLEND+DQVQE+LL ANT 
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   AVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
              EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 13. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 365.8 bits 1576,  Expect = 9e-103
 Identities = 260/274 94%, Positives = 268/274 97%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANTN 70
            MKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQVQE+LL AN  
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   AVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
             VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 336.9 bits 1449,  Expect = 5e-94
 Identities = 239/264 90%, Positives = 249/264 94%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN+RAEK E+++   QKK+QQ+EN++DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT   EK+KAL NAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEK 264
            FAERSVQKLQKEVDRLEDELVNEK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 15. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 331.6 bits 1426,  Expect = 2e-92
 Identities = 229/284 80%, Positives = 261/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ+ ++AN+RAEK+E++V  LQKK+QQ+EN++DQV
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT   EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 16. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 331.2 bits 1424,  Expect = 3e-92
 Identities = 233/283 82%, Positives = 252/283 89%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++ANIRAEKAE++   LQKK+QQ+END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L+  N    EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 17. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 330.7 bits 1422,  Expect = 4e-92
 Identities = 232/283 81%, Positives = 253/283 89%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++AN+RAEKAE++   LQKK+QQ+END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L+  N    EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 18. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 330.7 bits 1422,  Expect = 4e-92
 Identities = 227/284 79%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN++AEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE++  ANT   EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 19. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 330.0 bits 1419,  Expect = 6e-92
 Identities = 233/281 82%, Positives = 252/281 89%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN+RAEKAE++  +LQKK+Q +EN++DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L+  N    EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 20. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 329.8 bits 1418,  Expect = 7e-92
 Identities = 231/284 81%, Positives = 253/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNAMD A   EQQ ++AN+RAEKAE++   LQKK+QQ+END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L+  N    EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 21. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 327.8 bits 1409,  Expect = 3e-91
 Identities = 224/284 78%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN+RAEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L  ANT   EK+K+L  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSV+KLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 22. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 326.4 bits 1403,  Expect = 7e-91
 Identities = 224/284 78%, Positives = 262/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN+RAEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L  ANT   EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 325.7 bits 1400,  Expect = 1e-90
 Identities = 225/284 79%, Positives = 259/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ+ ++AN+RAEK+E++V  LQKK+QQ+EN++DQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  ANT   EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEA+++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 325.0 bits 1397,  Expect = 2e-90
 Identities = 228/281 81%, Positives = 249/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ ++AN+RAEKAE++  +LQKK+Q +END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QEAL+  N    EK+KAL NAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 25. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 221/284 77%, Positives = 259/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIK KMQAMKLE+DNA+DRA+  EQ+ ++AN+++EK E++V  LQKK+QQ+EN++DQV
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  A T   EK+KAL  AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T+KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 314.8 bits 1352,  Expect = 2e-87
 Identities = 223/281 79%, Positives = 244/281 86%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   E Q ++AN+RAEKAE++   LQKK+Q +END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            Q    L N     K+KAL NAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 298.1 bits 1279,  Expect = 2e-82
 Identities = 204/284 71%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ E+++   QKK+ Q END+D+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L +AN+N  EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 297.9 bits 1278,  Expect = 3e-82
 Identities = 204/284 71%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++   + E+ E+++   QKK+ Q END+D+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN+N  EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 294.3 bits 1262,  Expect = 3e-81
 Identities = 206/251 82%, Positives = 224/251 89%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDN MDRA   EQQ ++AN+RAEKAE++   LQKK+QQ+END+DQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L+  N    EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 278.5 bits 1193,  Expect = 2e-76
 Identities = 193/284 67%, Positives = 235/284 82%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIKKKMQAMKLEKDNAMD+AD LE Q ++AN +A+K  ++V  L+KK  Q+E DF   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +E L  AN N  +K+K L+N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            +R ++G+SKI+ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTLT KLK AEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 269.2 bits 1152,  Expect = 1e-73
 Identities = 183/284 64%, Positives = 230/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K E+D+N LQKK+  LENDFD +
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E LL ANT     +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 265.8 bits 1137,  Expect = 1e-72
 Identities = 184/284 64%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMKLEKDNA D+ADT E Q KEAN+RA+K  ++V +L K+L Q+  D ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +  L  AN +  EK+K L++ E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            +R ++GE+KI+ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+LT KLK AE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AE++V+KLQKEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 264.2 bits 1130,  Expect = 4e-72
 Identities = 182/284 64%, Positives = 229/284 80%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K E+D+N LQKK   LENDFD V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  A T     +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 260.3 bits 1113,  Expect = 6e-71
 Identities = 179/284 63%, Positives = 227/284 79%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K E+D+N LQKK   LENDFD V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  A       +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  +VLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 254.4 bits 1087,  Expect = 4e-69
 Identities = 175/284 61%, Positives = 221/284 77%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MD+IKKKM AMK+EK+NA DRA+ LEQQ ++   +  K E+D+  LQKK   LEN+FD V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E          E +K  S +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+K+++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 240.2 bits 1025,  Expect = 6e-65
 Identities = 165/284 58%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K E++ N+LQKKL   EN++D V
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L  ANT     +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 237.3 bits 1012,  Expect = 5e-64
 Identities = 163/284 57%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K EDD N L KK  Q END+D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
               L          +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 234.8 bits 1001,  Expect = 3e-63
 Identities = 162/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  R+++ EDD+  LQKKL+  E+++D+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EAL  A       +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAER+V KL+K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 39. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 233.4 bits 995,  Expect = 7e-63
 Identities = 161/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ EDD+  LQKKL+  E+++D+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+L  A       +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 219.3 bits 933,  Expect = 1e-58
 Identities = 151/228 66%, Positives = 184/228 80%, Gaps = 0/228 0%
Query  57   FDQVQEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
            FD V E      T   E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 214.7 bits 913,  Expect = 3e-57
 Identities = 151/282 53%, Positives = 206/282 73%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
            M+AIKKKMQ +K +K+NA DRA+  E   K +  + ++ ED++  LQKKL+  E++ D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             EAL  A       +K  ++AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAE++V KL+K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 59.3 bits 232,  Expect = 5e-10
 Identities = 63/256 24%, Positives = 130/256 50%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALL 65
            K+++ +KL+ DNA      + QQ ++   R E+ E     L+   + LE +++ ++  L 
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
Query  66   LANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  187  EESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 240
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  360  RIHEQEIEIKRLENERDELSAAYK 383
 Score = 42.6 bits 159,  Expect = 5e-05
 Identities = 56/260 21%, Positives = 130/260 50%, Gaps = 17/260 6%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAE----DDVNKLQKKLQQLENDFDQVQ 61
            +K  A K E+  A+ +   +E +  + N+R  +AE     ++ +L+KK Q       +++
Sbjct  411  EKRLAQKDEEIEALRKQYQIEIE--QLNMRLAEAEAKLKTEIARLKKKYQA---QITELE 465
Query  62   EALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAAD 121
             +L  AN   ++  K +     ++  L      +   L+++ ++L   T +  +A QA  
Sbjct  466  LSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGV-TQRRCQALQA-- 522
Query  122  ESERMRKVLE--NRSLSDEERM-DALENQLKEARFLAEEADRKYDEVARKLAMVEADLER 178
            E E MR  LE  NR+    E++ +    ++ E   +         ++  +++ ++AD + 
Sbjct  523  ELEEMRIALEQANRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDE 582
Query  179  AEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEAR 238
              +     + ++ +L  EL+   + L   +    K    +++ +++++TL  +++  EA 
Sbjct  583  VHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEAN 642
Query  239  A-EFAERSVQKLQKEVDRLEDELVNEKEKYKSITDEL 274
            A    +R + KL+  +  +E E V E+ +  + TD++
Sbjct  643  ALAGGKRVIAKLESRIRDVEIE-VEEERRRHAETDKM 678

Sequence Alignment: 43. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 73/258 28%, Positives = 137/258 53%, Gaps = 28/258 10%
Query  11   MKLEKDNAMDRADTLEQQNK-EANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANT 69
            ++LE+       D    ++K EA ++A    D+V +L++K+ Q  +++ +  EALL    
Sbjct  279  LELERQLTKANGDAASWKSKYEAELQAHV--DEVEELRRKMAQKISEYGEQLEALL-NKC 335
Query  70   NAVEKDKALSNAEGEVAALN-----RRIQLLEEDLERSEERLNTATTKLAEASQAADESE 124
            +A+EK KA   +E EV  ++        Q LE+ + + E+      +KL E S   ++++
Sbjct  336  SALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQ 395
Query  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
            +  +V     ++D +++     +L++ +   E   R+  ++A  LA  ++ L  A  R  
Sbjct  396  KDLRV----KIADLQKLQHEYEKLRDQK---EALARENKKLADDLAEAKSQLNDAHRRIH 448
Query  185  TGESKIVELE---EELRVVGNNLKSLEVSEEKANQREEAYKEQI-----KTLTNKLKAAE 236
              E +I  LE   EEL       ++L   EE  NQR  A   Q      K L  K +  E
Sbjct  449  EQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIE 508
Query  237  A-RAEFA---ERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTF 278
            A R ++    E+   +L +   +L+ E+   K+KY++   EL+ ++
Sbjct  509  ALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSL 554

Sequence Alignment: 44. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 49.9 bits 191,  Expect = 4e-07
 Identities = 61/256 23%, Positives = 131/256 51%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALL 65
            K+++ +KL+ DNA      + QQ ++   R E+ E   + L+   + LE +++ ++  L 
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLD 272
Query  66   LANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  273  DESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 326
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A     ++ +++A +E      +++ E 
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
                + + ++ELR+    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 445
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  446  RIHEQEIEIKRLENERDELSAAYK 469
 Score = 42.4 bits 158,  Expect = 7e-05
 Identities = 68/253 26%, Positives = 130/253 51%, Gaps = 29/253 11%
Query  4    IKKKMQAMKLEKDNAMDRADT----LEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQ 59
            +KKK QA   E + ++D A+     L++  K+  ++  + +   ++++++LQQ  + +  
Sbjct  539  LKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGV 598
Query  60   VQEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA-SQ 118
             Q           E   AL  A     A  +  QL EE + R  E L T    LA A S+
Sbjct  599  TQRRCQALQAELEEMRIALEQAS---RAKRQAEQLHEEAVVRVNE-LTTINVNLASAKSK 654
Query  119  AADESERMR----KVLENRSLSDEERMDALENQLKEAR-FLAEEADR--KYDEVARKLAM 171
               E   ++    +V +   +SDE R+  L  +LK  + +L EE +R  K + V + L  
Sbjct  655  LESEFSALQADYDEVHKELRISDE-RVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQ 713
Query  172  ----VEADLERAEERAETGESKIV-ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIK 226
                +   +E  E  A  G  +++ +LE  +R V      +EV EE+  +R    ++ ++
Sbjct  714  EVRTLHVRIEEVEANALAGGKRVIAKLESRIRDV-----EIEVEEER--RRHAETEKMLR 766
Query  227  TLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK 268
               +++K    + E   + +Q LQ+  D+L +++   K + +
Sbjct  767  KKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEKVKVYKRQMQ 808

Sequence Alignment: 45. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 49.5 bits 189,  Expect = 5e-07
 Identities = 67/266 25%, Positives = 143/266 53%, Gaps = 26/266 9%
Query  1    MDAIKKKMQ---AMKLEKDNAMDRADT-LEQQNKEANIRAEKAEDDVNKLQKKLQQLEND 56
            +D+++  +    A ++E ++ +  A+T + Q   + +       ++V  L+KK+ Q + +
Sbjct  266  LDSVRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAE 325
Query  57   FDQVQEALLLANTNAVEKDKALSNAEGEVAALN-RRIQLLEEDLERSEERLNTATTKLAE 115
            +++ Q  ++L   + +EK KA   +E EV  ++  + Q     LER++E+L         
Sbjct  326  YEE-QIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLE-------- 376
Query  116  ASQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEAD 175
              Q  +   R+ ++L     +  E   AL  +L++ + L E+A  + + +AR+   ++ D
Sbjct  377  -KQVLEMKSRIDELLVELEAAQREARAALA-ELQKMKQLYEKAVEQKEALARENKKLQDD 434
Query  176  LERAEERAETGESKIVELE-EELRVVGNNLKSLEVS--EEKANQRE-EAYKEQIKTLTNK 231
            L  A E       K+ EL+ E  R+ G  ++ L+V+  E +A +R+ EA  ++      +
Sbjct  435  LHEANEALADANRKLHELDLENARLAGE-IRDLQVALKESEAARRDAEARAQRALAELQQ 493
Query  232  LKAA-EARAEFAERSVQKLQK----EVDRLEDELVNEKEKYKSITDELDQTF 278
            ++   E R +  E  ++ L+K    E+DRL   L + + + K+    L + +
Sbjct  494  VRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIARLRKKY 545

Sequence Alignment: 46. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 49.0 bits 187,  Expect = 7e-07
 Identities = 86/271 31%, Positives = 144/271 53%, Gaps = 51/271 18%
Query  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANIRAEKAEDDVNKLQKK 49
            M+ +K++MQ    +LE        K++++++A T L  + KE  I  E  +  V  L K+
Sbjct  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
Query  50   LQQLENDFDQVQEAL--LLANTNAVEKDKAL----------SNAE--GEVAALNRRIQLL 95
             +QLEN+   +Q  +  L    N +  +KAL          SNAE       L R  + L
Sbjct  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
Query  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
Query  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
Query  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
Query  262  NEKEKYKSITDELDQTFSELSG 283
              + K  ++  EL+   + L G
Sbjct  594  VAERKRVALAQELEDARALLEG 615

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.