The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV
QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAX37288 Pen m 1 284 1720 398.6 1.3e-112
EU410072 Lit v 1.0101 284 1720 398.6 1.3e-112
11893851 Pen a 1 284 1720 398.6 1.3e-112
AAC48288 Hom a 1.0102 284 1691 392.0 1.3e-110
D3XNR9 Mac r 1.0101 284 1687 391.1 2.4e-110
M1H607 Por p 1.0101 284 1676 388.6 1.4e-109
C0LU07 Pro c 1.0101 284 1667 386.6 5.6e-109
CBY17558 Pan b 1.0101 284 1661 385.2 1.5e-108
Q25456 Met e 1 274 1650 382.7 7.9e-108
M4M2H6 Mel l 1.0101 284 1637 379.7 6.4e-107
O61379 Pan s 1 274 1625 377.0 4.1e-106
O44119 Hom a 1.0101 284 1603 372.0 1.4e-104
A7L5V2 Scy p 1.0101 284 1598 370.8 3.1e-104
Q9N2R3 Cha f 1 264 1464 340.3 4.4e-95
AEX31649 Cho a 10.0101 284 1443 335.5 1.3e-93
BAA04557 Der f 10.0101 299 1439 334.6 2.7e-93
AAD19606 Per a 7.0102 284 1436 333.9 4e-93
AAF72534 Bla g 7.0101 284 1436 333.9 4e-93
Q9UB83 Per a 7 284 1432 333.0 7.5e-93
NP_001103782 Bomb m 3.0101 285 1432 333.0 7.6e-93
ABU97466 Blo t 10.0101 284 1428 332.1 1.4e-92
Q9NFZ4 Lep d 10 284 1424 331.2 2.7e-92
O18416 Der p 10 284 1413 328.7 1.5e-91
AAT40866 Tyr p 10.0101 284 1401 325.9 1e-90
Q17H75 Aed a 10.0101 285 1400 325.7 1.2e-90
CAA09938 Chi k 10 285 1353 315.0 2e-87
Q9NAS5 Ani s 3 284 1296 302.0 1.6e-83
ACN32322 Asc l 3.0101 287 1293 301.3 2.6e-83
AGM32377.1 Copt f 7.0101 256 1276 297.5 3.3e-82
CAC84590 Lep s 1 284 1197 279.4 1e-76
CAB38044 Hel as 1 284 1145 267.6 3.7e-73
Q17H80 Aed a 10.0201 284 1144 267.3 4.3e-73
APG42675 Hal l 1.0101 284 1129 263.9 4.7e-72
AAG08987 Hal d 1 284 1117 261.2 3.1e-71
AVD53650 Sac g 1.0101 284 1084 253.7 5.7e-69
AAG08989 Mim n 1 284 1024 240.0 7.5e-65
NP_001117128 Sal s 4.0101 284 999 234.3 3.9e-63
AAG08988 Per v 1 284 997 233.8 5.3e-63
XP_026775428 Pan h 4.0201 284 997 233.8 5.3e-63
AAK96889 Cra g 1 233 931 218.9 1.4e-58
XP_026781482 Pan h 4.0101 284 921 216.5 8.7e-58
AAK39511 Der f 11.0101 692 247 62.7 4.3e-11
AAM83103 Blo t 11 875 216 55.6 7.4e-09
AAO73464 Der p 11 875 202 52.4 6.7e-08
QPB41107 Rap v 2.0101 859 200 52.0 9e-08
AAF72796 Ani s 2 869 189 49.5 5.2e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 398.6 bits 1720,  Expect = 1e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 2. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 398.6 bits 1720,  Expect = 1e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 3. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 398.6 bits 1720,  Expect = 1e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 4. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 392.0 bits 1691,  Expect = 1e-110
 Identities = 280/284 98%, Positives = 280/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEKSEEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 5. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 391.1 bits 1687,  Expect = 2e-110
 Identities = 279/284 98%, Positives = 281/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LLKAN +L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 6. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 388.6 bits 1676,  Expect = 1e-109
 Identities = 277/284 97%, Positives = 279/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKD+AMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQV
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 7. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 386.6 bits 1667,  Expect = 6e-109
 Identities = 275/284 96%, Positives = 279/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQA KLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQ+LENDLDQV
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESLLKAN QL EKDKA+SNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 8. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 385.2 bits 1661,  Expect = 1e-108
 Identities = 275/284 96%, Positives = 279/284 98%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEV  LQK++QQLENDLD V
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LLKAN +L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 382.7 bits 1650,  Expect = 8e-108
 Identities = 273/274 99%, Positives = 273/274 99%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
            MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 10. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 270/284 95%, Positives = 278/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+E++V+ LQK++QQLEND+DQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+LL AN   VEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 377.0 bits 1625,  Expect = 4e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 12. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 372.0 bits 1603,  Expect = 1e-104
 Identities = 265/284 93%, Positives = 273/284 96%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   +K+MQQ+EN+LDQV
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 370.8 bits 1598,  Expect = 3e-104
 Identities = 263/284 92%, Positives = 271/284 95%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 340.3 bits 1464,  Expect = 4e-95
 Identities = 242/264 91%, Positives = 250/264 94%, Gaps = 0/264 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEAN RAEK+EEE+   QK+MQQ+EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL NAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEK 264
            FAERSVQKLQKEVDRLEDELVNEK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 15. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 335.5 bits 1443,  Expect = 1e-93
 Identities = 231/284 81%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN +AEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QES+ +AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 16. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 334.6 bits 1439,  Expect = 3e-93
 Identities = 232/284 81%, Positives = 261/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ+ ++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 17. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 333.9 bits 1436,  Expect = 4e-93
 Identities = 234/283 82%, Positives = 256/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 18. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 333.9 bits 1436,  Expect = 4e-93
 Identities = 234/283 82%, Positives = 255/283 90%, Gaps = 0/283 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSG 283
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 333.0 bits 1432,  Expect = 8e-93
 Identities = 233/284 82%, Positives = 256/284 90%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNAMD A   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 20. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 333.0 bits 1432,  Expect = 8e-93
 Identities = 236/281 83%, Positives = 253/281 90%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ K+AN RAEK+EEE   LQK++Q +EN+LDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL++ N +L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 21. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 332.1 bits 1428,  Expect = 1e-92
 Identities = 228/284 80%, Positives = 264/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL +AN +L EK+K+L  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSV+KLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 22. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 331.2 bits 1424,  Expect = 3e-92
 Identities = 228/284 80%, Positives = 263/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ++++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QESL +AN +L EK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 328.7 bits 1413,  Expect = 2e-91
 Identities = 228/284 80%, Positives = 259/284 91%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIK KMQAMKLEKDNA+DRA+  EQ+ ++AN RAEKSEEEV  LQK++QQ+EN+LDQV
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN +L EK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEA+++QI+ +T KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 325.9 bits 1401,  Expect = 1e-90
 Identities = 223/284 78%, Positives = 262/284 92%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIK KMQAMKLE+DNA+DRA+  EQ+ ++AN ++EK+EEEV  LQK++QQ+EN+LDQV
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L +A  +L EK+KAL  AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESERMRK+LE+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGESKIVELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T+KLK AEARAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 325.7 bits 1400,  Expect = 1e-90
 Identities = 229/281 81%, Positives = 249/281 88%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   EQQ ++AN RAEK+EEE   LQK++Q +ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE+L+  N +L EK+KAL NAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 315.0 bits 1353,  Expect = 2e-87
 Identities = 224/281 79%, Positives = 244/281 86%, Gaps = 0/281 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA+DRA   E Q ++AN RAEK+EEE   LQK++Q +ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            Q      N +L  K+KAL NAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSEL 281
            FAERSVQKLQKEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 302.0 bits 1296,  Expect = 2e-83
 Identities = 207/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN  L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAETGE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 301.3 bits 1293,  Expect = 3e-83
 Identities = 207/284 72%, Positives = 246/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK+EKDNA+DRAD  E++ ++  ++ E+ EEE+ + QK+M Q ENDLD+ 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            QE L  AN  L EK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER+RKV+ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE GE+KIVELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            FAERSVQKLQKEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 297.5 bits 1276,  Expect = 3e-82
 Identities = 208/251 82%, Positives = 227/251 90%, Gaps = 0/251 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDN MDRA   EQQ ++AN RAEK+EEE  +LQK++QQ+ENDLDQ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L++ N +L EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RK+LE++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE+GESKIVELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVQKLQK 251
            FAERSVQKLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 279.4 bits 1197,  Expect = 1e-76
 Identities = 193/284 67%, Positives = 238/284 83%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQAMKLEKDNAMD+AD LE Q ++AN +A+K  EEV++L+K+  Q+E D+   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            +E+L  AN  L +K+K L+N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            +R ++G+SKI+ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTLT KLK AEARAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
            +AE+ V+KLQKEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 181/284 63%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D +
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E LL AN +L   +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 267.3 bits 1144,  Expect = 4e-73
 Identities = 187/284 65%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMKLEKDNA D+ADT E Q KEAN RA+K  EEV  L KR+ Q+  D ++ 
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
            + +L +AN  L EK+K L++ E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DE+ RM KVLENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            +R ++GE+KI+ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+LT KLK AE RAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AE++V+KLQKEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 263.9 bits 1129,  Expect = 5e-72
 Identities = 180/284 63%, Positives = 232/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +A  +L   +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 261.2 bits 1117,  Expect = 3e-71
 Identities = 178/284 62%, Positives = 231/284 81%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +A  +L   +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  +VLE+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+KI+ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 253.7 bits 1084,  Expect = 6e-69
 Identities = 173/284 60%, Positives = 222/284 78%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MD+IKKKM AMK+EK+NA DRA+ LEQQ ++   +  K EE++  LQK+   LEN++D V
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E       +  E +K  S +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+K+++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ LT +LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 240.0 bits 1024,  Expect = 7e-65
 Identities = 164/284 57%, Positives = 215/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQAMK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E L +AN +L   +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLE RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  ++K++ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER V KLQKEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 234.3 bits 999,  Expect = 4e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             ESL  A  +L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
               L     +    +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 39. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 159/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +R+++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+L  A  +L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAER+V KL+K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 218.9 bits 931,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  57   LDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 216.5 bits 921,  Expect = 9e-58
 Identities = 149/282 52%, Positives = 210/282 74%, Gaps = 0/282 0%
Query  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
            M+AIKKKMQ +K +K+NA DRA+  E   K + ++ ++ E+E+  LQK+++  E+++D+ 
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
             E+L  A  +L   +K  ++AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
            DESER  KV+ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
            ERAE  E K  +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282
            FAE++V KL+K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 62.7 bits 247,  Expect = 4e-11
 Identities = 64/256 25%, Positives = 134/256 52%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  127  KEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLD 186
Query  66   KANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
            + +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  187  EESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 240
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A R   ++ +++A +E      + + E 
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
                + + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 359
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  360  RIHEQEIEIKRLENERDELSAAYK 383
 Score = 39.2 bits 144,  Expect = 0.0005
 Identities = 64/237 27%, Positives = 119/237 50%, Gaps = 34/237 14%
Query  22   ADTLEQQNKEANNRAEKSEEEV-HNLQKRMQQLENDLD----QVQESLLKANIQLVEKDK 76
            A+TL +Q +  N R      +V H+ +KR+ Q + +++    Q Q  + + N++L E + 
Sbjct  385  AETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA 444
Query  77   ALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLS 136
             L     E+A L ++ Q    +LE S +  N A   L +  +        ++ L+   L 
Sbjct  445  KLKT---EIARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITEL- 492
Query  137  DEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLER---AEERAETGESKIVEL 193
             +   D +  QL++A       D +     R+   ++A+LE    A E+A   + +  +L
Sbjct  493  -QAHYDEVHRQLQQA------VD-QLGVTQRRCQALQAELEEMRIALEQANRAKRQAEQL 544
Query  194  EEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEV 253
             EE  V  N L ++ V+   A  + E+   +   L             ++  VQKL  E+
Sbjct  545  HEEAVVRVNELTTINVNLASAKSKLES---EFSALQADYDEVHKELRISDERVQKLTIEL 601
Query  254  DRLEDELVNEKE---KYKSITDELDQTFSEL 281
               +D L+ E+E   K +++   L+Q    L
Sbjct  602  KSTKDLLIEEQERLVKLETVKKSLEQEVRTL 632

Sequence Alignment: 43. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 58/255 22%, Positives = 127/255 49%, Gaps = 10/255 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++  K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L 
Sbjct  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
Query  66   KANIQLVEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
            + +   +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
Query  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
Query  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
Query  244  RSVQKLQKEVDRLEDELVNEKEKYK 268
            R +++ + E+ RLE+E       YK
Sbjct  445  RRIHEQEIEIKRLENEREELAAAYK 469
 Score = 41.5 bits 154,  Expect = 0.0001
 Identities = 62/224 27%, Positives = 109/224 48%, Gaps = 27/224 12%
Query  22   ADTLEQQNKEANNR--AEKSEEEVHNLQKRMQQLENDLD----QVQESLLKANIQLVEKD 75
            A+TL +Q +  N R  AE ++   H+ +KR+ Q E +++    Q Q  + + N++L E +
Sbjct  471  AETLRKQEEAKNQRLTAELAQTR-HDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAE 529
Query  76   KALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSL 135
              L     EVA L ++ Q    +LE S +  N A   L +  +        ++ L+   L
Sbjct  530  AKLKT---EVARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITGL 578
Query  136  SDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIVELEE 195
              +   D +  QL++A        R+   +  +L  +  +LE+A       E    ++ E
Sbjct  579  --QAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRAAE----QMHE 632
Query  196  ELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDR 255
            E  V  N L ++ V+   A  + E    +   L N           ++  VQKL  EV  
Sbjct  633  EAVVRVNELTTINVNLASAKSKLET---EFSALQNDYDEVHKELRISDERVQKLTIEVKS 689
Query  256  LEDELVNEKEK 266
             +D L +E E+
Sbjct  690  TKDLLESETER 700

Sequence Alignment: 44. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 62/256 24%, Positives = 133/256 51%, Gaps = 8/256 3%
Query  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
            K+++ +KL+ DNA      + QQ ++  +R E+ E +  +L+   + LE +L+ ++  L 
Sbjct  213  KEVHEVKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLD 272
Query  66   KANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESER 125
              +   +E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E 
Sbjct  273  DESEARLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEE 326
Query  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAET 185
              + L N+  S E++   L+++++      E+A     ++ +++A +E      +++ E 
Sbjct  327  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEE 386
Query  186  GESKIVELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAER 244
                + + ++ELR+    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R
Sbjct  387  VTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHR 445
Query  245  SVQKLQKEVDRLEDELVNEKEKYK 268
             +++ + E+ RLE+E       YK
Sbjct  446  RIHEQEIEIKRLENERDELSAAYK 469
 Score = 43.3 bits 162,  Expect = 4e-05
 Identities = 64/237 27%, Positives = 119/237 50%, Gaps = 34/237 14%
Query  22   ADTLEQQNKEANNRAEKSEEEV-HNLQKRMQQLENDLD----QVQESLLKANIQLVEKDK 76
            A+TL +Q +  N R      +V H+ +KR+ Q + +++    Q Q  + + N++L E + 
Sbjct  471  AETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA 530
Query  77   ALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLS 136
             L     E+A L ++ Q    +LE S +  N A   L +  +        ++ L+   L 
Sbjct  531  KLKT---EIARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITEL- 578
Query  137  DEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLER---AEERAETGESKIVEL 193
             +   D +  QL++A       D +     R+   ++A+LE    A E+A   + +  +L
Sbjct  579  -QAHYDEVHRQLQQA------VD-QLGVTQRRCQALQAELEEMRIALEQASRAKRQAEQL 630
Query  194  EEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEV 253
             EE  V  N L ++ V+   A  + E+   +   L             ++  VQKL  E+
Sbjct  631  HEEAVVRVNELTTINVNLASAKSKLES---EFSALQADYDEVHKELRISDERVQKLTIEL 687
Query  254  DRLEDELVNEKE---KYKSITDELDQTFSEL 281
               +D L+ E+E   K +++   L+Q    L
Sbjct  688  KSTKDLLIEEQERLVKLETVKKSLEQEVRTL 718

Sequence Alignment: 45. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 52.0 bits 200,  Expect = 9e-08
 Identities = 85/271 31%, Positives = 147/271 54%, Gaps = 51/271 18%
Query  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKR 49
            M+ +K++MQ    +LE        K++++++A T L  + KE     E ++  V++L KR
Sbjct  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
Query  50   MQQLENDLDQVQESL---------LKANIQLVEKDKA---LSNAE--GEVAALNRRIQLL 95
             +QLEN+   +Q  +         L+    L+E+D     +SNAE       L R  + L
Sbjct  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
Query  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
Query  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
Query  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
Query  262  NEKEKYKSITDELDQTFSELSG 283
              + K  ++  EL+   + L G
Sbjct  594  VAERKRVALAQELEDARALLEG 615

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 49.5 bits 189,  Expect = 5e-07
 Identities = 71/266 26%, Positives = 143/266 53%, Gaps = 26/266 9%
Query  1    MDAIKKKMQ---AMKLEKDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKRMQQLEND 56
            +D+++  +    A ++E ++ +  A+T + Q   + +       EEV +L+K+M Q + +
Sbjct  266  LDSVRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAE 325
Query  57   LDQVQESLLKANIQLVEKDKALSNAEGEVAALN-RRIQLLEEDLERSEERLNTATTKLAE 115
             ++  E +L+   QL EK KA   +E EV  ++  + Q     LER++E+L         
Sbjct  326  YEEQIEIMLQKVSQL-EKAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLE-------- 376
Query  116  ASQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEAD 175
              Q  +   R+ ++L     +  E   AL  +L++ + L E+A  + + +AR+   ++ D
Sbjct  377  -KQVLEMKSRIDELLVELEAAQREARAALA-ELQKMKQLYEKAVEQKEALARENKKLQDD 434
Query  176  LERAEERAETGESKIVELE-EELRVVGNNLKSLEVS--EEKANQRE-EAYKEQIKTLTNK 231
            L  A E       K+ EL+ E  R+ G  ++ L+V+  E +A +R+ EA  ++      +
Sbjct  435  LHEANEALADANRKLHELDLENARLAGE-IRDLQVALKESEAARRDAEARAQRALAELQQ 493
Query  232  LKAA-EARAEFAERSVQKLQK----EVDRLEDELVNEKEKYKSITDELDQTF 278
            ++   E R +  E  ++ L+K    E+DRL   L + + + K+    L + +
Sbjct  494  VRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIARLRKKY 545

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.