The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY
SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA
DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE
ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI
Sequence Info Allergen Name Length Opt Bits Score E Value
NP_001117128 Sal s 4.0101 284 1712 396.8 4.6e-112
XP_026775428 Pan h 4.0201 284 1609 373.3 5.4e-105
XP_026781482 Pan h 4.0101 284 1403 326.4 7.3e-91
CBY17558 Pan b 1.0101 284 1015 237.9 3.1e-64
A7L5V2 Scy p 1.0101 284 1007 236.1 1.1e-63
AAT40866 Tyr p 10.0101 284 1006 235.9 1.3e-63
D3XNR9 Mac r 1.0101 284 1006 235.9 1.3e-63
AEX31649 Cho a 10.0101 284 1006 235.9 1.3e-63
ABU97466 Blo t 10.0101 284 1005 235.7 1.5e-63
Q9NAS5 Ani s 3 284 1003 235.2 2e-63
BAA04557 Der f 10.0101 299 1002 235.0 2.6e-63
C0LU07 Pro c 1.0101 284 1001 234.8 2.8e-63
M1H607 Por p 1.0101 284 1000 234.5 3.3e-63
AAC48288 Hom a 1.0102 284 1000 234.5 3.3e-63
O44119 Hom a 1.0101 284 1000 234.5 3.3e-63
AAX37288 Pen m 1 284 999 234.3 3.9e-63
11893851 Pen a 1 284 999 234.3 3.9e-63
EU410072 Lit v 1.0101 284 999 234.3 3.9e-63
Q9NFZ4 Lep d 10 284 998 234.1 4.5e-63
ACN32322 Asc l 3.0101 287 998 234.1 4.6e-63
NP_001103782 Bomb m 3.0101 285 997 233.8 5.3e-63
M4M2H6 Mel l 1.0101 284 995 233.4 7.3e-63
O18416 Der p 10 284 986 231.3 3e-62
Q17H75 Aed a 10.0101 285 984 230.9 4.1e-62
O61379 Pan s 1 274 950 223.1 8.5e-60
CAA09938 Chi k 10 285 949 222.9 1e-59
Q9N2R3 Cha f 1 264 948 222.7 1.1e-59
Q25456 Met e 1 274 947 222.5 1.4e-59
APG42675 Hal l 1.0101 284 943 221.5 2.7e-59
AAD19606 Per a 7.0102 284 942 221.3 3.1e-59
AAG08987 Hal d 1 284 941 221.1 3.7e-59
CAB38044 Hel as 1 284 941 221.1 3.7e-59
AAF72534 Bla g 7.0101 284 940 220.8 4.3e-59
AVD53650 Sac g 1.0101 284 933 219.3 1.3e-58
Q9UB83 Per a 7 284 926 217.7 3.9e-58
AAG08988 Per v 1 284 866 204.0 5.2e-54
AAG08989 Mim n 1 284 860 202.6 1.3e-53
AGM32377.1 Copt f 7.0101 256 854 201.3 3e-53
CAC84590 Lep s 1 284 849 200.1 7.6e-53
Q17H80 Aed a 10.0201 284 823 194.2 4.6e-51
AAK96889 Cra g 1 233 786 185.8 1.2e-48
AAO73464 Der p 11 875 202 52.4 6.7e-08
AAK39511 Der f 11.0101 692 200 52.0 7.2e-08
AAF72796 Ani s 2 869 197 51.3 1.5e-07
QPB41107 Rap v 2.0101 859 196 51.1 1.7e-07
AAM83103 Blo t 11 875 162 43.3 3.7e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 396.8 bits 1712,  Expect = 5e-112
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI 284
            FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI 284

Sequence Alignment: 2. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 373.3 bits 1609,  Expect = 5e-105
 Identities = 264/284 92%, Positives = 276/284 97%, Gaps = 0/284 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQMLKLDKENALDRAE AE DKKAAED+SKQLEDDLVALQKKLKGTEDELDKY
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            SE+LKDAQEKLE++EK A DAEADVASLNRRIQLVEEELDRAQERLATAL KLEEAEKAA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERGMKVIENRA KDEEKME+Q+IQLKEAKHIAEEADRKYEEVARKLVI+E +LERTE
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAELSEGKC+ELEEELKTVTN LKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI 284
            FAER+VAKLEKTIDDLEDELY+QKLKYKAISEELD+ALNDMTSI
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284

Sequence Alignment: 3. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 326.4 bits 1403,  Expect = 7e-91
 Identities = 228/284 80%, Positives = 258/284 90%, Gaps = 0/284 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIKKKMQMLK DKENA+DRAE AE DKK +EDK KQLED+L+ LQKKLKGTEDE+DKY
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            SE+LKDAQEKLE++EK ATDAE +VA+LNRRIQL+EEELDRAQ RL TAL KLEEAEK A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERGMKVIENRA KDEEKME+Q++QLKEAK+IAE++DRKY+EVARKLV+IE +LER E
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE+SE K  +LEEELK VTN LKSLEAQAEKYS KEDKYEEEI +L +KLKEAETRAE
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMTSI 284
            FAE++V+KLEKTIDDLEDELY QKLK KAI EELDNALNDMT++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMTTL 284

Sequence Alignment: 4. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 237.9 bits 1015,  Expect = 3e-64
 Identities = 162/282 57%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQKKL+  E++LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L  A + LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 5. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 236.1 bits 1007,  Expect = 1e-63
 Identities = 162/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++ A QKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A  KL+  EK   +AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 6. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 163/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIK KMQ +KL+++NA+DRAE AE   + A  KS++ E+++ ALQKK++  E+ELD+ 
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L  A  KLE  EK    AEADVA+LNRRIQL+EE+L+R++ERL  A  KLEEA  +A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+M+  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KY++IS+ELD  + ++T
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELT 282

Sequence Alignment: 7. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L  A + LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 8. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 163/282 57%, Positives = 216/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIKKKMQ +KL+K+NA+DRAE AE   + A  K+++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ES+  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA  AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+M+  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282

Sequence Alignment: 9. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 235.7 bits 1005,  Expect = 1e-63
 Identities = 163/282 57%, Positives = 218/282 77%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIKKKMQ +KL+K+NA+DRAE AE   + A  ++++ E+++ ALQKK++  E+ELD+ 
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  KLE  EK+   AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA  +A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+M+  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282

Sequence Alignment: 10. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 235.2 bits 1003,  Expect = 2e-63
 Identities = 164/282 58%, Positives = 212/282 75%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +K++K+NALDRA+ AE   +   DK +++E++L   QKK+  TE++LDK 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A   LE  EK   +AEA+VA+LNRR+ L+EEEL+RA+ERL  A  KLEEA   A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+ +DEE+    + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+ED YEE+I+ ++ +LKEAETRAE
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K +YK+ISEELD  + +++
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELS 282

Sequence Alignment: 11. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 235.0 bits 1002,  Expect = 3e-63
 Identities = 162/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIKKKMQ +KL+K+NA+DRAE AE   + A  ++++ E+++ ALQKK++  E+ELD+ 
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA ++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+M+  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 297

Sequence Alignment: 12. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 234.8 bits 1001,  Expect = 3e-63
 Identities = 161/282 57%, Positives = 218/282 77%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ  KL+K+NA+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  ++++T
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELT 282

Sequence Alignment: 13. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 234.5 bits 1000,  Expect = 3e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K++A+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+ ++ELD A+++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELS 282

Sequence Alignment: 14. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 234.5 bits 1000,  Expect = 3e-63
 Identities = 160/282 56%, Positives = 219/282 77%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 15. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 234.5 bits 1000,  Expect = 3e-63
 Identities = 161/282 57%, Positives = 216/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++   +KK++  E+ELD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A  KLE  EK   +AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 16. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 234.3 bits 999,  Expect = 4e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 17. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 234.3 bits 999,  Expect = 4e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 18. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 234.3 bits 999,  Expect = 4e-63
 Identities = 160/282 56%, Positives = 220/282 78%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  +L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 19. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 161/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIK KMQ +KL+K+NA+DRAE AE   + A  ++++ E+++  LQKK++  E+ELD+ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL  A  KLE  EK+   AE DVA+LNRRIQL+EE+L+R++ RL  A +KLEEA ++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+ME  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ YE++I+++T KLKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELT 282

Sequence Alignment: 20. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 164/282 58%, Positives = 212/282 75%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +K++K+NALDRA+ AE   +   DK +++E++L   QKK+  TE++LDK 
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A   LE  EK   +AEA+VA+LNRR+ L+EEEL+RA+ERL  A  KLEEA   A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+ +DEE+    + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+ED YEE+I+ ++ +LKEAETRAE
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K +YK+ISEELD  + +++
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELS 282

Sequence Alignment: 21. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 164/281 58%, Positives = 215/281 76%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NALDRA   E   K A  ++++ E++   LQKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             ESL     KLE  EK   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   QESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E++Y+ +IK LT +LKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL A+K KYK I ++LD A+ ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 22. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 233.4 bits 995,  Expect = 7e-63
 Identities = 161/282 57%, Positives = 217/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ EDD+  LQKKL+  E+++D+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L  A       +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 282

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 231.3 bits 986,  Expect = 3e-62
 Identities = 160/282 56%, Positives = 215/282 76%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIK KMQ +KL+K+NA+DRAE AE   + A  ++++ E+++ ALQKK++  E+ELD+ 
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A  KLE  EK    AE DVA+LNRRIQL+EE+L+R++ERL  A  KLEEA ++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E+R+  DEE+ME  + QLKEA+ +AE+ADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK  Q+E+ +E++I+++T KLKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            FAERSV KL+K +  LEDEL  +K KYK+IS+ELD  + ++T
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELT 282

Sequence Alignment: 24. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 230.9 bits 984,  Expect = 4e-62
 Identities = 160/281 56%, Positives = 214/281 76%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NALDRA   E   + A  ++++ E++   LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L     KLE  EK   +AE++VA+LNRRIQL+EE+L+R++ERLA+A  KL EA  AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENRA  DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  EGK  ELEEEL+ V NNLKSLE   EK +Q+E++Y+ +IK LT +LKEAE RAE
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL  +K KY+ I ++LD A+ ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 25. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 223.1 bits 950,  Expect = 8e-60
 Identities = 152/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  11   LKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKYSESLKDAQEK 70
            +KL+K+NA+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+  ESL  A  +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   LEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVI 130
            LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AADESER  KV+
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKC 190
            ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER EERAE  E K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  SELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLE 250
             ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAERSV KL+
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 222.9 bits 949,  Expect = 1e-59
 Identities = 155/281 55%, Positives = 210/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NALDRA   E   + A  ++++ E++   LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
                     KLE  EK   +AE++VA+LNRRIQL+ E+LDR++ERLA+A  KL EA  AA
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++ENR+  DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E++Y+ +IK LT +LKEAE RAE
Sbjct  181  ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL ++K KY+ I ++LD A+ ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 222.7 bits 948,  Expect = 1e-59
 Identities = 155/264 58%, Positives = 201/264 76%, Gaps = 0/264 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA+  E   K A  ++++ E+++ A QKK++  E+ELD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L  A  KL+  EK   +AE +VA+LNRRIQL EE+L+R++ERL TA TKL EA +AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER E
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK L +KLK AE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQK 264
            FAERSV KL+K +D LEDEL  +K
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 28. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 222.5 bits 947,  Expect = 1e-59
 Identities = 151/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  11   LKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKYSESLKDAQEK 70
            +KL+K+NA+DRA+  E   K A +++++ E+++  LQK+++  E++LD+  ESL  A  +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   LEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVI 130
            L   +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AADESER  KV+
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKC 190
            ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER EERAE  E K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  SELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLE 250
             ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAERSV KL+
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272

Sequence Alignment: 29. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 221.5 bits 943,  Expect = 3e-59
 Identities = 153/281 54%, Positives = 208/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKM  +K++KENA+DRAE  E   +  E++  ++E+DL  LQKK    E+++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +E L++A  KLE +EK  T+ E +V+   R+I L+EE+L+R +ERL TA  +LEEA KAA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERG KV+E+R+  D+E+++  + QLKEAK+IAE+A+RKY+E ARKL I E DLER E
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER+V+KL+K +D LEDEL A+K KYKAIS+ELD  + ++
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 30. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 221.3 bits 942,  Expect = 3e-59
 Identities = 152/281 54%, Positives = 212/281 75%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA   E   + A  ++++ E++  +LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L     KL+  +K   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E++   DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK + +E++Y+++IK LT +LKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL  +K KYK I ++LD  + ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTEL 281

Sequence Alignment: 31. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 221.1 bits 941,  Expect = 4e-59
 Identities = 152/281 54%, Positives = 208/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKM  +K++KENA+DRAE  E   +  E++  ++E+DL  LQKK    E+++D  
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +E L++A  KLE +EK  T+ E +V+   R+I L+EE+L+R +ERL TA  +LEEA KAA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERG +V+E+R+  D+E+++  + QLKEAK+IAE+A+RKY+E ARKL I E DLER E
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER+V+KL+K +D LEDEL A+K KYKAIS+ELD  + ++
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 32. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 221.1 bits 941,  Expect = 4e-59
 Identities = 154/281 54%, Positives = 208/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKM  +K++KENALDRAE  E   +  E    ++E+DL  LQKK+   E+++D  
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +E L DA  KLE +EK   + E++ A L RRIQL+EE+L+R++ERL +A  KLEEA KAA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESERG KV+E+R+  D+E+++  + QLKEAK+IAE+A+RK++E ARKL I E DLER E
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER+V+KL+K +D LEDEL A+K +YKA S+ELD+ + ++
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAEL 281

Sequence Alignment: 33. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 220.8 bits 940,  Expect = 4e-59
 Identities = 151/281 53%, Positives = 211/281 75%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+DRA   E   + A  ++++ E++  +LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L     KL+  +K   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E++   DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK + +E++Y+++IK L  +LKEAE RAE
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL  +K KYK I ++LD  + ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTEL 281

Sequence Alignment: 34. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 219.3 bits 933,  Expect = 1e-58
 Identities = 151/281 53%, Positives = 206/281 73%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MD+IKKKM  +K++KENA DRAE  E   +  E++  ++E+DL  LQKK    E+E+D  
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +E  +D Q K E AEK A+++E ++ SLNRRIQL+EE+++R++ERL TA  KLEEA KAA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+EN  +  EE+ ++ + QL EAK IAEEAD+KY+E ARKL I E DLER E
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E +E K  +LEE+L  V NN+K+L+ Q ++ SQ+ED YEE I+ LT +LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER+V+KL+K +D LEDEL A+K +YKAIS+ELD  + ++
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 281

Sequence Alignment: 35. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 217.7 bits 926,  Expect = 4e-58
 Identities = 150/281 53%, Positives = 210/281 74%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA+D A   E   + A  ++++ E++  +LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L     KL+  +K   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +A 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E++   DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK + +E++Y+++IK LT +LKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            FAERSV KL+K +D LEDEL  +K KYK I ++LD  + ++
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTEL 281

Sequence Alignment: 36. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 204.0 bits 866,  Expect = 5e-54
 Identities = 146/281 51%, Positives = 198/281 70%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKM  +K++K+NALDRAE  E   +  E+   ++EDD  +L KK   TE++ D  
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +  L+D Q K E AEK   + E ++ SL R+I L+EE + +A+ER+ TA  KLEEA KAA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+EN  S ++E+++  + QL EAK IAEEAD+KYEE ARKL I E DLER E
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E +E K  +LEE+L  V  N+K+L+ Q ++ SQ+ED YEE I+ LT++LK+AE RA 
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER+V+KL+K +D LEDEL  +K KYKAIS+ELD  + ++
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281

Sequence Alignment: 37. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 202.6 bits 860,  Expect = 1e-53
 Identities = 142/281 50%, Positives = 195/281 69%, Gaps = 0/281 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +K+D+ENA D AE  E   K  E    +LE+++  LQKKL  TE+  D  
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
            +E L++A  KLE +EK  T  E+DV  L RR+ L+EE+ +R++E+L +   KLEEA KAA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  KV+E R++  EE+++  + QL+ AK++A +AD K++E ARKL I E DLER E
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
             R E ++ K  ELEEEL  V  N+K+L+ Q ++ SQ+ED YEE I+ LT  LK+AE RA 
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             AER V KL+K +D LEDEL A+K +YKAIS++LD  + ++
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281

Sequence Alignment: 38. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 201.3 bits 854,  Expect = 3e-53
 Identities = 138/251 54%, Positives = 191/251 76%, Gaps = 0/251 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+N +DRA   E   + A  ++++ E++  +LQKK++  E++LD+ 
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E L     KL+  +K   +AE++VA+LNRRIQL+EE+L+R++ERLATA  KL EA +AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DESER  K++E++   DEE+M+  + QLKEA+ +AEEAD+KY+EVARKL ++E+DLER E
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            ERAE  E K  ELEEEL+ V NNLKSLE   EK + +E++Y+++IK LT +LKEAE RAE
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  FAERSVAKLEK 251
            FAERSV KL+K
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 39. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 200.1 bits 849,  Expect = 8e-53
 Identities = 137/282 48%, Positives = 203/282 71%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            M+AIKKKMQ +KL+K+NA+D+A+  E   + A  K+ ++ +++  L+KK    E ++   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
             E+L  A + LE  EKT T+ E++VASLNR++Q++EE L+R++ERL TALTKL EA  AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DE+ R  KV+ENR+ +DEE+M+    QLKEA+ +AE+AD K +EV+RK+  +E DLE  E
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            +R +  + K  ELEEELK V N+LKSLE   EK +Q+ ++Y+ +IK LT KLKEAE RAE
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
            +AE+ V KL+K +D LEDEL   K +Y+A+++E+D  + +++
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELS 282

Sequence Alignment: 40. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 194.2 bits 823,  Expect = 5e-51
 Identities = 133/282 47%, Positives = 202/282 71%, Gaps = 0/282 0%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
            MDAIKKKMQ +KL+K+NA D+A+  E   K A  ++ ++ +++  L K+L    ++ +K+
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
              +L+ A + LE  EK  T  EA+VA+L R++Q VEE+L++++ER   AL+KL EA ++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
            DE+ R  KV+ENR+ +DEE+M+    QLKEA+ +AE+AD K +EV+RKL  +E +LE  E
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            +R +  E K  ELEEELK V N+LKSLE   +K +Q+ ++++ ++K LT KLKEAETRAE
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDMT 282
             AE++V KL+K +D LED+L  +K KYKAI ++LD+ + ++T
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELT 282

Sequence Alignment: 41. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 185.8 bits 786,  Expect = 1e-48
 Identities = 129/225 57%, Positives = 170/225 75%, Gaps = 0/225 0%
Query  57   LDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEA 116
            +D  +E  ++ Q K+E AEKTA++AE ++ SLNRRIQL+EE+++R++ERL TA  KLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  EKAADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDL 176
             KAADESER  KV+EN  +  EE+ ++ + QL EAK IAEEAD+KY+E ARKL I E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAE 236
            ER E R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  TRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
             RA  AER+V+KL+K +D LEDEL A+K +YKAIS+ELD  + ++
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230

Sequence Alignment: 42. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 75/271 27%, Positives = 141/271 52%, Gaps = 32/271 11%
Query  4    IKKKMQMLKLDKENALDRAEGAEG--DKKAAEDKSK------QLE----DDLVALQ--KK 49
            +++K Q    + ++ LD+ + A+   DK+  + +++      QLE    + L AL+  +K
Sbjct  116  LRQKHQAAVHEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLSQLETANKEKLTALKSVEK 175
Query  50   LKGTEDELDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATA 109
            L+ T  EL+   E +     +L   ++  T    +   L + ++ V+ +LD A       
Sbjct  176  LEYTVHELNIKIEEINRTVIELTSHKQRLTQENTE---LIKEVHEVKLQLDNANHLKQQI 232
Query  110  LTKLEEAEKAADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYE----EV 165
              +LE+     +E ER    +EN A   E ++E   +QL +      E +R+      + 
Sbjct  233  AQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEARLELERQLTKANGDA 292
Query  166  ARKLVIIESDLE-RTEERAELSEG---KCSELEEELKTVTNNLKSLEAQAEKYSQKEDKY 221
            A      E++L+   +E  EL      K SE EE+L+ + N   SLE Q       + + 
Sbjct  293  ASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQ-------KSRL 345
Query  222  EEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281
            + E++VL   L++A   A+  E+ VA+LEK   DL+D+L    +  +   +EL   + ++
Sbjct  346  QSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIKIGEL 405
Query  282  TSI 284
              +
Sbjct  406  QKL 408

Sequence Alignment: 43. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 52.0 bits 200,  Expect = 7e-08
 Identities = 67/240 27%, Positives = 132/240 55%, Gaps = 28/240 11%
Query  11   LKLDKENALDR--AEGAEGDKKAAEDKSKQ---LEDDLVALQKKLKGTEDELDKYSESLK 65
            L+LD  N L    A+  E  +   E++ ++   LE+    L+ +L+  + +LD+ SE+  
Sbjct  134  LQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA-- 191
Query  66   DAQEKLEVAEKTATDAEADVASLNRR----IQLVEEELDRAQERLATALTKLEEAEKAAD 121
                +LE+ E+  T A  D AS   +    +Q   +E++  + ++A  +++ EE  +A  
Sbjct  192  ----RLEL-ERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALL 246
Query  122  ESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLE-RTE 180
                 +   E + S+ + ++E+  + L++A   A++ +++  ++ +    I  DL+ + E
Sbjct  247  NKCSSL---EKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEK----INLDLKNKLE 299
Query  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
            E   L E    + ++EL+     L+ L+ + EK   + D+   E K LTD L EA+++  
Sbjct  300  EVTMLME----QAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLN 355
Query  241  FAERSVAKLEKTIDDLEDELYAQKLKYK 268
             A R + + E  I  LE+E       YK
Sbjct  356  DAHRRIHEQEIEIKRLENERDELSAAYK 383

Sequence Alignment: 44. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 77/255 30%, Positives = 130/255 50%, Gaps = 31/255 12%
Query  12   KLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQK--KLKGTEDELDKYSE----SLK 65
            K+D E AL   E  +  KK  + +++  E   + LQK  +L+  +  L    E     L+
Sbjct  300  KFDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLE 359
Query  66   DAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER 125
             AQ  + + E+     E  V  +  RI  +  EL+ AQ     AL +L++ ++  +    
Sbjct  360  KAQNTIAILERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAELQKMKQLYE---- 415
Query  126  GMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEV----AR---KLVIIESDLER 178
              K +E + +   E  +LQD  L EA     +A+RK  E+    AR   ++  ++  L+ 
Sbjct  416  --KAVEQKEALARENKKLQD-DLHEANEALADANRKLHELDLENARLAGEIRDLQVALKE 472
Query  179  TEERAELSEGKCSELEEELKTVTNNL-KSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAET 237
            +E     +E +      EL+ V   + + L+ + E+        + EI  LT  L +AE 
Sbjct  473  SEAARRDAEARAQRALAELQQVRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEA 532
Query  238  R--AEFA------ERSVAKLEKTIDDLED-ELYAQKLKYKAISEEL 274
            R  AE A      +  +A+LE T+D+L    L AQK   K  SE++
Sbjct  533  RMKAEIARLRKKYQAEIAELEMTVDNLNRANLEAQKT-IKKQSEQI 577
 Score = 42.8 bits 160,  Expect = 5e-05
 Identities = 60/226 26%, Positives = 116/226 51%, Gaps = 34/226 15%
Query  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQL---EDDLVALQKKLKGTEDEL 57
            + A+  +++  K   +NA+   + AE D + A  +   L     +L A++ KL   E EL
Sbjct  605  ISALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNKL---ETEL 661
Query  58   DKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRA----------QERLA 107
                  L +  ++L  A++ A  A AD A   R +Q + EE + +          +E++ 
Sbjct  662  STAQADLDEVTKELHAADERANRALADAA---RAVQELHEEQEHSMKIDALRKSLEEQVK 718
Query  108  TALTKLEEAEKAADES-ERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVA 166
                +++EAE AA    +R +  +E R    E  ++ +  + KE +    + DR+ +EV 
Sbjct  719  QLQVQIQEAEAAALLGGKRVIAKLETRIRDLEVALDEETRRHKETQSALRKKDRRIKEV- 777
Query  167  RKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIK 226
                  +  ++   +   +++     + E+L      L   EA   +  Q+  +Y+ E  
Sbjct  778  ------QMQIDEEHKMFVMAQDTADRMLEKLNIQKRQLGEAEAMTMQNLQRVRRYQRE-- 829
Query  227  VLTDKLKEAETRAEFAERSV 246
                 L++AE RA+ AE S+
Sbjct  830  -----LEDAEGRADQAESSL 844
 Score = 41.0 bits 152,  Expect = 0.0002
 Identities = 61/224 27%, Positives = 131/224 58%, Gaps = 32/224 14%
Query  33   EDKSKQLEDDLVALQKKLKGT-EDELDKYSESLKDAQEKLEVAEKTATDAEADVASLNRR 91
            EDK + L+DD+ + +++L+   E E    S  L    ++L+ AE  ATD++ + ++  R 
Sbjct  38   EDKIRLLQDDFES-ERELRNRIERERADLSVQLIALTDRLQDAE-CATDSQIE-SNRKRE 94
Query  92   IQL--VEEELDRAQERLATALTKLEEAEKAA--DESERGMKVIENRASK-DEEKMELQ-D 145
            ++L  + + L+ +Q     A+  L +  +    D +E+ ++ ++ + SK D E+  LQ +
Sbjct  95   VELSKLRKLLEESQLENEDAMNVLRKKHQDVCLDYTEQ-IEQLQKKNSKIDRERQRLQHE 153
Query  146  I--------QLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEEL 197
            +        QL++ KH+AE+  +K+E+   +L     DL +     +L++ +   L+ E 
Sbjct  154  VIELTATIDQLQKDKHVAEKMAQKFEQQTIELSNKVEDLNK--HVNDLAQQR-QRLQAEN 210
Query  198  KTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLE 257
              +   +   + Q +  + +  KY+     L  +L+E+  R E AER  ++++  +  ++
Sbjct  211  SDLLAEIHDQKVQLD--NLQHVKYQ-----LAQQLEESRRRLEDAERERSQMQAQLHQVQ 263
Query  258  DELYAQKLKYKAISEE 273
             EL + ++   A+ EE
Sbjct  264  LELDSVRV---ALDEE 276

Sequence Alignment: 45. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 51.1 bits 196,  Expect = 2e-07
 Identities = 80/243 32%, Positives = 131/243 53%, Gaps = 39/243 16%
Query  2    DAIKKKMQMLKLDKENA--LDRAEGAEGDKKAAEDKSKQLEDDLVALQ---KKLKGTEDE 56
            D  K+  Q   L+ ENA    R E   G+     ++   LE D+  L+    +L    D 
Sbjct  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
Query  57   LDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEA 116
            L + ++ L D   +  +A K A    AD+  L  R QL E E D     LA AL   EEA
Sbjct  418  LQRENKHLSDQLREANLALKDANRELADLRQL--RSQL-EAERD----SLAAALKDTEEA 470
Query  117  EKAADESERGMKVIENRASKD-EEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESD 175
             + A+      +   N+   D E ++  +D   +E +++   + R  EE+ R LV +E  
Sbjct  471  LRDAEAKLASAQAALNQLKIDMENRLREKD---EEIENVRRSSARAIEELQRTLVEVE-- 525
Query  176  LERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEA 235
               T  + E+S  K        K   ++++ LEA  +  ++   +Y ++IK L  ++KE 
Sbjct  526  ---TRYKTEISRMK--------KKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKEL 574
Query  236  ETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNA 277
            ET  E  ER V+      DDL ++L   + K  A+++EL++A
Sbjct  575  ETLLE-EERRVS------DDLRNQLGVAERKRVALAQELEDA 609
 Score = 40.3 bits 149,  Expect = 0.0003
 Identities = 62/259 23%, Positives = 123/259 47%, Gaps = 23/259 8%
Query  5    KKKMQMLKLDKENALDRA--EGAEGD-KKAAEDKSKQLEDDLVALQKKLKGTEDELDKYS 61
            K++ +++KL K+  L  A  E  E   +K  ++    L D +  L K     E E     
Sbjct  86   KRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKEKQTLV 145
Query  62   ESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEE--AEKA 119
              L     +LE   K     E+ V +  R    ++ ++D    +L + LT L+    ++ 
Sbjct  146  VELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQL-SELTSLKSRLTQEN 204
Query  120  ADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLE-- 177
             D   +  ++  N A+  + + +LQ       +++ +E  R+ + +   L  +++D +  
Sbjct  205  FDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDET-RQRQNLQVNLSALQADYDNL 263
Query  178  --RTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEK-YSQKEDKYEEEIKVLTDKLKE 234
              R EE AE S    + L  +L  V  +  +L+++ +K  + K ++ E+  + +  ++ E
Sbjct  264  NVRLEEEAETS----TNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQVRITE 319
Query  235  AETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDN 276
             E   E      + LEK    L +E+       K I+ EL+N
Sbjct  320  LEDTCEQLRVKNSSLEKAKTKLANEI-------KEITIELEN 354

Sequence Alignment: 46. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 43.3 bits 162,  Expect = 4e-05
 Identities = 66/269 24%, Positives = 142/269 52%, Gaps = 36/269 13%
Query  4    IKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQ-LEDDLVALQKKLK-GTEDEL---- 57
            +++K Q    + ++ LD+ + A    K   DK KQ ++ ++  L  +++   +D+L    
Sbjct  116  LRQKHQAAIQEMQDQLDQVQKA----KNKSDKEKQKFQAEVFELLAQVETANKDKLVAQK 171
Query  58   --DKYSESLKDAQEKLEVAEKTATDAEADVASLNRRI-QLVEE------ELDRAQERLAT 108
              +K   ++ +   K+E   +T  +  A    L++   +L++E       LD A      
Sbjct  172  TVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQ 231
Query  109  ALTKLEEAEKAADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEV--- 165
               +LE+     ++ ER    +EN A   E ++E   +QL+E      E +R+  +    
Sbjct  232  IAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGD 291
Query  166  -----ARKLVIIESDLERTEE-RAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKED 219
                 ++    +++ ++  EE R ++++ K SE  E+L+ + N   +LE Q       + 
Sbjct  292  AASWKSKYEAELQAHVDEVEELRRKMAQ-KISEYGEQLEALLNKCSALEKQ-------KA 343
Query  220  KYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALN 279
            + + E++VL   L++A   A+  E+ V++LEK   DL+ +L    +  +   ++L   + 
Sbjct  344  RLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIA 403
Query  280  DMTSI 284
            D+  +
Sbjct  404  DLQKL 408

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.