The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC
NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA
DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE
ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT
EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAG08988 Per v 1 284 1736 402.3 1e-113
AVD53650 Sac g 1.0101 284 1393 324.1 3.6e-90
APG42675 Hal l 1.0101 284 1298 302.5 1.2e-83
AAG08987 Hal d 1 284 1291 300.9 3.6e-83
AAG08989 Mim n 1 284 1223 285.4 1.6e-78
CAB38044 Hel as 1 284 1218 284.2 3.6e-78
AAK96889 Cra g 1 233 1071 250.8 3.4e-68
A7L5V2 Scy p 1.0101 284 1012 237.3 5e-64
M4M2H6 Mel l 1.0101 284 1012 237.3 5e-64
O44119 Hom a 1.0101 284 1006 235.9 1.3e-63
ACN32322 Asc l 3.0101 287 1006 235.9 1.3e-63
D3XNR9 Mac r 1.0101 284 1004 235.4 1.8e-63
Q9NAS5 Ani s 3 284 1002 235.0 2.4e-63
CBY17558 Pan b 1.0101 284 999 234.3 3.9e-63
AAC48288 Hom a 1.0102 284 998 234.1 4.5e-63
AAX37288 Pen m 1 284 997 233.8 5.3e-63
11893851 Pen a 1 284 997 233.8 5.3e-63
EU410072 Lit v 1.0101 284 997 233.8 5.3e-63
M1H607 Por p 1.0101 284 989 232.0 1.9e-62
C0LU07 Pro c 1.0101 284 988 231.8 2.2e-62
AAD19606 Per a 7.0102 284 986 231.3 3e-62
BAA04557 Der f 10.0101 299 985 231.1 3.8e-62
Q9UB83 Per a 7 284 984 230.9 4.1e-62
AAF72534 Bla g 7.0101 284 980 230.0 7.8e-62
ABU97466 Blo t 10.0101 284 977 229.3 1.3e-61
AEX31649 Cho a 10.0101 284 977 229.3 1.3e-61
NP_001103782 Bomb m 3.0101 285 976 229.1 1.5e-61
Q17H75 Aed a 10.0101 285 975 228.8 1.7e-61
AAT40866 Tyr p 10.0101 284 973 228.4 2.4e-61
O18416 Der p 10 284 959 225.2 2.1e-60
Q9NFZ4 Lep d 10 284 958 225.0 2.5e-60
CAA09938 Chi k 10 285 957 224.7 3e-60
O61379 Pan s 1 274 948 222.7 1.2e-59
Q25456 Met e 1 274 945 222.0 1.9e-59
Q9N2R3 Cha f 1 264 901 212.0 1.9e-56
NP_001117128 Sal s 4.0101 284 866 204.0 5.2e-54
XP_026775428 Pan h 4.0201 284 861 202.8 1.1e-53
CAC84590 Lep s 1 284 843 198.7 2e-52
Q17H80 Aed a 10.0201 284 835 196.9 6.9e-52
AGM32377.1 Copt f 7.0101 256 834 196.7 7.1e-52
XP_026781482 Pan h 4.0101 284 775 183.2 9.1e-48
QPB41107 Rap v 2.0101 859 225 57.7 1.7e-09
AAK39511 Der f 11.0101 692 190 49.7 3.5e-07
AAF72796 Ani s 2 869 191 49.9 3.8e-07
AAO73464 Der p 11 875 190 49.7 4.5e-07
AAM83103 Blo t 11 875 146 39.7 0.00047
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 402.3 bits 1736,  Expect = 1e-113
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC
Sbjct  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA
Sbjct  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
            ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT
Sbjct  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 2. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 324.1 bits 1393,  Expect = 4e-90
 Identities = 229/284 80%, Positives = 253/284 89%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MD+IKKKM+AMKMEK+NA DRAEQLEQ+LR+TEE KAKIE+D  +L KK+   EN++D  
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            N + QD QAKYE AEK+  E EQEIQSL R+I LLEE + ++EER+ TA+ KLEEASKAA
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESERNRKVLENLN+ ++ER D LEKQLTEAK IAEEADKKY+EAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
            ARLEAAEAKVIDLEEQL+VVG NIKTLQVQNDQASQREDSYEETIRDLT RLKDAENRAT
Sbjct  181  ARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAERTVSKLQKEVDRLEDELL EKE+YKAISDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 3. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 302.5 bits 1298,  Expect = 1e-83
 Identities = 210/284 73%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM+AMKMEK+NA+DRAEQ EQKLR+TEE KAKIE+D N+L KK    END+DN 
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            N QLQ+   K E +EK++ E EQE+   TRKI+LLEE + + EER+ TA+ +LEEASKAA
Sbjct  61   NEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLE+ +  +DERIDQLE QL EAK+IAE+A++KY+EAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
            ARLEAAEAK+++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAENRAT
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAERTVSKLQKEVDRLEDELL EKEKYKAISDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 4. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 300.9 bits 1291,  Expect = 4e-83
 Identities = 209/284 73%, Positives = 245/284 86%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM+AMKMEK+NA+DRAEQ EQKLR+TEE KAKIE+D N+L KK    END+DN 
Sbjct  1    MDAIKKKMLAMKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            N QLQ+  AK E +EK++ E EQE+   TRKI+LLEE + + EER+ TA+ +LEEASKAA
Sbjct  61   NEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER  +VLE+ +  +DERIDQLE QL EAK+IAE+A++KY+EAARKLAITEVDLERAE
Sbjct  121  DESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
            ARLEAAEAK+++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAENRAT
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAERTVSKLQKEVDRLEDELL EKEKYKAISDELD TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 5. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 285.4 bits 1223,  Expect = 2e-78
 Identities = 198/284 69%, Positives = 239/284 84%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK++++NA D AEQ+EQKL++TE AKAK+E+++N L KK   TEN+YD  
Sbjct  1    MDAIKKKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            N QLQ+   K E +EKQI + E ++  L R+++LLEE   ++EE++ + + KLEEASKAA
Sbjct  61   NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESERNRKVLE  ++  +ERID+LEKQL  AK +A +AD K++EAARKLAITEVDLERAE
Sbjct  121  DESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             RLEAA+AKV++LEE+LTVVGANIKTLQVQNDQASQREDSYEETIRDLT  LKDAENRAT
Sbjct  181  TRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRAT 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAER V KLQKEVDRLEDELL EKE+YKAISD+LD TFAE+AGY
Sbjct  241  EAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 6. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 284.2 bits 1218,  Expect = 4e-78
 Identities = 198/284 69%, Positives = 238/284 83%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM+AMKMEK+NALDRAEQ+EQKLR+ E  K K+E+D N+L KK    END+D+ 
Sbjct  1    MDAIKKKMLAMKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSI 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            N QL D   K E +EK+  E E E   L R+I LLEE + ++EER+ +A+ KLEEASKAA
Sbjct  61   NEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLE+ +  +DER+D LE QL EAK+IAE+A++K++EAARKLAITEVDLERAE
Sbjct  121  DESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
            ARLEAAEAK+++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAENRA+
Sbjct  181  ARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRAS 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            EAERTVSKLQKEVDRLEDELL EKE+YKA SDELD+TFAELAGY
Sbjct  241  EAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 7. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 250.8 bits 1071,  Expect = 3e-68
 Identities = 176/228 77%, Positives = 198/228 86%, Gaps = 0/228 0%
Query  57   YDNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEA 116
            +D  N + Q+ Q K E AEK   E EQEIQSL R+I LLEE + ++EER+ TA+ KLEEA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  117  SKAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDL 176
            SKAADESERNRKVLENLN+ ++ER D LEKQLTEAK IAEEADKKY+EAARKLAITEVDL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  177  ERAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAE 236
            ERAEARLEAAEAKV++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  237  NRATEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            NRATEAERTVSKLQKEVDRLEDELL EKE+YKAISDELD TFAELAGY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 8. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 237.3 bits 1012,  Expect = 5e-64
 Identities = 161/284 56%, Positives = 214/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++  +  KK  Q EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL     K +  EK +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 237.3 bits 1012,  Expect = 5e-64
 Identities = 163/284 57%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K EDD N L KK  Q END+D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L          +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 162/284 57%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++     KK  Q EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL     K E  EK +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 235.9 bits 1006,  Expect = 1e-63
 Identities = 161/284 56%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NALDRA+  E+K+R+  +   +IE++     KK +QTEND D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L    +  E  EK++QE E E+ +L R+++LLEE + +AEER+  A+ KLEEA+  A
Sbjct  61   QEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKV+EN +  ++ER + +E QL EA+ +AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R EA E K+++LEE+L VVG N+K+L+V  ++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+IS+ELD TF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 12. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 235.4 bits 1004,  Expect = 2e-63
 Identities = 160/284 56%, Positives = 214/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L       E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 235.0 bits 1002,  Expect = 2e-63
 Identities = 159/284 55%, Positives = 211/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NALDRA+  E+K+R+  +   +IE++     KK +QTEND D  
Sbjct  1    MDAIKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKA 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L    +  E  EK++QE E E+ +L R+++LLEE + +AEER+  A+ KLEEA+  A
Sbjct  61   QEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKV+EN +  ++ER + +E QL EA+ +AEEAD+KY+E ARKL + E DLERAE
Sbjct  121  DESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E K+++LEE+L VVG N+K+L+V  ++A QREDSYEE IR ++ RLK+AE RA 
Sbjct  181  ERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKE+YK+IS+ELD TF EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 14. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 234.3 bits 999,  Expect = 4e-63
 Identities = 161/284 56%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++   L KK  Q END D+ 
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L       E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 234.1 bits 998,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     + E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 16. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     +    +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 17. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     +    +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 18. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 233.8 bits 997,  Expect = 5e-63
 Identities = 159/284 55%, Positives = 213/284 75%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     +    +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 19. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 232.0 bits 989,  Expect = 2e-62
 Identities = 157/284 55%, Positives = 212/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK +A+DRA+ LEQ+ +E      K E++ ++L K+  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     + E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ +DELD  F+EL+GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 20. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 231.8 bits 988,  Expect = 2e-62
 Identities = 158/284 55%, Positives = 211/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM A K+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  + END D  
Sbjct  1    MDAIKKKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     + E  +K I   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+I+DELD TF+EL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 21. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 231.3 bits 986,  Expect = 3e-62
 Identities = 160/283 56%, Positives = 208/283 73%, Gaps = 0/283 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA   EQ+ R+      K E++  SL KK  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL  V AK +  +K +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+    ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAG 283
             AER+V KLQKEVDRLEDEL+ EKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 22. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 231.1 bits 985,  Expect = 4e-62
 Identities = 159/284 55%, Positives = 211/284 74%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIKKKM AMK+EK NA+DRAE  EQK R+      K E++  +L KK  Q EN+ D  
Sbjct  16   MEAIKKKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 75
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS++A
Sbjct  76   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 135
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER+D LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  136  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 195
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  196  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 255
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  256  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 23. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 230.9 bits 984,  Expect = 4e-62
 Identities = 160/284 56%, Positives = 208/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+D A   EQ+ R+      K E++  SL KK  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL  V AK +  +K +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+A 
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAV 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+    ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK I D+LD TF ELAGY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 24. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 230.0 bits 980,  Expect = 8e-62
 Identities = 159/283 56%, Positives = 206/283 72%, Gaps = 0/283 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA   EQ+ R+      K E++  SL KK  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL  V AK +  +K +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+    ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A+ RE+ Y++ I+ L  RLK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAG 283
             AER+V KLQKEVDRLEDEL+ EKEKYK I D+LD TF EL G
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 25. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 229.3 bits 977,  Expect = 1e-61
 Identities = 158/284 55%, Positives = 208/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIKKKM AMK+EK NA+DRAE  EQK R+      K E++  +L KK  Q EN+ D  
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS +A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER+D LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  FAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 26. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 229.3 bits 977,  Expect = 1e-61
 Identities = 158/284 55%, Positives = 208/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIKKKM AMK+EK NA+DRAE  EQK R+      K E++   L KK  Q EN+ D  
Sbjct  1    MEAIKKKMQAMKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               +     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS AA
Sbjct  61   QESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER+D LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 27. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 229.1 bits 976,  Expect = 1e-61
 Identities = 161/280 57%, Positives = 206/280 73%, Gaps = 2/280 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQT-ENDYDN 59
            MDAIKKKM AMK+EK NALDRA   EQ+ ++      K E++   L KK IQT EN+ D 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKK-IQTIENELDQ 59
Query  60   CNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKA 119
                L  V  K E  EK +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+A
Sbjct  60   TQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQA 119
Query  120  ADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERA 179
            ADESER RKVLEN +  ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERA
Sbjct  120  ADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERA 179
Query  180  EARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRA 239
            E R E+ E+K+++LEE+L VVG N+K+L+V  ++A+QRE+ Y+  I+ LT RLK+AE RA
Sbjct  180  EERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARA 239
Query  240  TEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
              AER+V KLQKEVDRLEDEL+ EKEKYK I D+LD  F EL
Sbjct  240  EFAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 28. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 228.8 bits 975,  Expect = 2e-61
 Identities = 160/281 56%, Positives = 201/281 71%, Gaps = 0/281 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NALDRA   EQ+ R+      K E++   L KK    END D  
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L  V AK E  EK +Q  E E+ +L R+I LLEE + ++EER+ +A+ KL EAS AA
Sbjct  61   QEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN    ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERAE
Sbjct  121  DESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R EA E K+++LEE+L VVG N+K+L+V  ++A+QRE+ Y+  I+ LT RLK+AE RA 
Sbjct  181  ERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
             AER+V KLQKEVDRLEDEL+ EKEKY+ I D+LD  F EL
Sbjct  241  FAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 29. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 228.4 bits 973,  Expect = 2e-61
 Identities = 156/284 54%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIK KM AMK+E+ NA+DRAE  EQK R+      K E++  +L KK  Q EN+ D  
Sbjct  1    MDAIKNKMQAMKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS +A
Sbjct  61   QENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER+D LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T++LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKY++ISDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 30. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 225.2 bits 959,  Expect = 2e-60
 Identities = 155/284 54%, Positives = 209/284 73%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIK KM AMK+EK NA+DRAE  EQK R+      K E++  +L KK  Q EN+ D  
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL     K E  EK +Q  E ++ +L R+I L+EE + ++EER+  A+ KLEEAS++A
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER++ LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE+++E+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEV RLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 31. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 225.0 bits 958,  Expect = 3e-60
 Identities = 155/284 54%, Positives = 207/284 72%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIK KM AMK+EK NA+DRAE  EQK R+      K E++   L KK  Q EN+ D  
Sbjct  1    MEAIKNKMQAMKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L     K E  EK +Q  E ++ +L R+I L+EE + ++E R+  A+ KLEEAS++A
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+ +  ++ER++ LE QL EA+ +AE+AD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E  E+K+++LEE+L VVG N+K+L+V  ++A QRE++YE+ IR +T +LK+AE RA 
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AER+V KLQKEVDRLEDEL+ EKEKYK+ISDELD TFAEL GY
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 32. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 224.7 bits 957,  Expect = 3e-60
 Identities = 160/280 57%, Positives = 205/280 73%, Gaps = 2/280 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQT-ENDYDN 59
            MDAIKKKM AMK+EK NALDRA   E + R+      K E++  +L KK IQT END D 
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKK-IQTIENDLDQ 59
Query  60   CNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKA 119
               Q   V  K E  EK +Q  E E+ +L R+I LL E + ++EER+ +A+ KL EAS A
Sbjct  60   TQGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAA 119
Query  120  ADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERA 179
            ADESER RK+LEN +  ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERA
Sbjct  120  ADESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERA 179
Query  180  EARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRA 239
            E R EA EAK+++LEE+L VVG N+K+L+V  ++A+QRE+ Y+  I+ LT RLK+AE RA
Sbjct  180  EERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARA 239
Query  240  TEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
              AER+V KLQKEVDRLEDEL++EKEKY+ I D+LD  F EL
Sbjct  240  EFAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 33. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 222.7 bits 948,  Expect = 1e-59
 Identities = 151/274 55%, Positives = 204/274 74%, Gaps = 0/274 0%
Query  11   MKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAK 70
            MK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D     L     +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  71   YERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADESERNRKVL 130
             E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AADESER RKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKV 190
            EN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE R E  E+K 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  191  IDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQ 250
            ++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA  AER+V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            KEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 34. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 222.0 bits 945,  Expect = 2e-59
 Identities = 150/274 54%, Positives = 204/274 74%, Gaps = 0/274 0%
Query  11   MKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAK 70
            MK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D     L     +
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  71   YERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADESERNRKVL 130
                +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AADESER RKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  131  ENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKV 190
            EN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE R E  E+K+
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  191  IDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQ 250
            ++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA  AER+V KLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  251  KEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
            KEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 35. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 212.0 bits 901,  Expect = 2e-56
 Identities = 145/264 54%, Positives = 194/264 73%, Gaps = 0/264 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA+DRA+ LEQ+ +E      K E++  +  KK  Q EN+ D  
Sbjct  1    MDAIKKKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQA 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL     K +  EK +Q  E E+ +L R+I L EE + ++EER+ TA+ KL EAS+AA
Sbjct  61   QEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RKVLEN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE
Sbjct  121  DESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ L N+LK AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEK 264
             AER+V KLQKEVDRLEDEL+ EK
Sbjct  241  FAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 36. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 204.0 bits 866,  Expect = 5e-54
 Identities = 146/281 51%, Positives = 198/281 70%, Gaps = 0/281 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM  +K++K+NALDRAE  E   +  E+   ++EDD  +L KK   TE++ D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            +  L+D Q K E AEK   + E ++ SL R+I L+EE + +A+ER+ TA  KLEEA KAA
Sbjct  61   SESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER  KV+EN  S ++E+++  + QL EAK IAEEAD+KYEE ARKL I E DLER E
Sbjct  121  DESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E +E K  +LEE+L  V  N+K+L+ Q ++ SQ+ED YEE I+ LT++LK+AE RA 
Sbjct  181  ERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
             AER+V+KL+K +D LEDEL  +K KYKAIS+ELD  + ++
Sbjct  241  FAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281

Sequence Alignment: 37. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 202.8 bits 861,  Expect = 1e-53
 Identities = 145/281 51%, Positives = 199/281 70%, Gaps = 0/281 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM  +K++K+NALDRAEQ E   +  E+   ++EDD  +L KK   TE++ D  
Sbjct  1    MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKY 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            +  L+D Q K E +EK+  + E ++ SL R+I L+EE + +A+ER+ TA  KLEEA KAA
Sbjct  61   SEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER  KV+EN    ++E+++  E QL EAK IAEEAD+KYEE ARKL I E +LER E
Sbjct  121  DESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E +E K  +LEE+L  V   +K+L+ Q ++ SQ+ED YEE I+ LT++LK+AE RA 
Sbjct  181  ERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
             AERTV+KL+K +D LEDEL ++K KYKAIS+ELD  + ++
Sbjct  241  FAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281

Sequence Alignment: 38. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 198.7 bits 843,  Expect = 2e-52
 Identities = 137/284 48%, Positives = 196/284 69%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIKKKM AMK+EK NA+D+A+ LE + R+      KI ++   L KK  Q E D+   
Sbjct  1    MEAIKKKMQAMKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L       E  EK +   E E+ SL RK+ ++EE + ++EER+ TA  KL EAS AA
Sbjct  61   KENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DE+ R  KVLEN +  ++ER+DQL  QL EA+ +AE+AD K +E +RK+A  E DLE AE
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R+++ ++K+++LEE+L VVG ++K+L+V  ++A+QR + Y+  I+ LT +LK+AE RA 
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AE+ V KLQKEVDRLEDEL   K++Y+A++DE+D TFAEL+GY
Sbjct  241  YAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 39. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 196.9 bits 835,  Expect = 7e-52
 Identities = 136/284 47%, Positives = 194/284 68%, Gaps = 0/284 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK NA D+A+  E + +E      KI ++   L K+  Q   D++  
Sbjct  1    MDAIKKKMQAMKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKF 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
               L+      E  EK +   E  + +LTRK+  +EE + K+EER   A  KL EA+++A
Sbjct  61   KNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DE+ R  KVLEN +  ++ER+DQL  QL EA+ +AE+AD K +E +RKLA  E +LE AE
Sbjct  121  DENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R+++ EAK+++LEE+L VVG ++K+L+V  D+A+QR + ++  ++ LT +LK+AE RA 
Sbjct  181  DRVKSGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284
             AE+ V KLQKEVDRLED+L+ EK+KYKAI D+LD+TFAEL GY
Sbjct  241  NAEKNVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 40. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 196.7 bits 834,  Expect = 7e-52
 Identities = 135/251 53%, Positives = 181/251 72%, Gaps = 0/251 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            MDAIKKKM AMK+EK N +DRA   EQ+ R+      K E++  SL KK  Q END D  
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQT 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
              QL  V AK +  +K +Q  E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AA
Sbjct  61   MEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER RK+LE+    ++ER+D LE QL EA+++AEEADKKY+E ARKLA+ E DLERAE
Sbjct  121  DESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E+ E+K+++LEE+L VVG N+K+L+V  ++A+ RE+ Y++ I+ LT RLK+AE RA 
Sbjct  181  ERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAE 240
Query  241  EAERTVSKLQK 251
             AER+V KLQK
Sbjct  241  FAERSVQKLQK 251

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 183.2 bits 775,  Expect = 9e-48
 Identities = 134/281 47%, Positives = 190/281 67%, Gaps = 0/281 0%
Query  1    MDAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNC 60
            M+AIKKKM  +K +K+NA+DRAEQ E   + +E+   ++ED+   L KK   TE++ D  
Sbjct  1    MEAIKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKY 60
Query  61   NTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAA 120
            +  L+D Q K E +EK+  + E E+ +L R+I L+EE + +A+ R+ TA  KLEEA K A
Sbjct  61   SEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQA 120
Query  121  DESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAE 180
            DESER  KV+EN    ++E+++  E QL EAK IAE++D+KY+E ARKL + E +LERAE
Sbjct  121  DESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  181  ARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRAT 240
             R E +E K  DLEE+L  V   +K+L+ Q ++ S +ED YEE I  L  +LK+AE RA 
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  241  EAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
             AE+TVSKL+K +D LEDEL  +K K KAI +ELD  + ++
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDM 281

Sequence Alignment: 42. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 57.7 bits 225,  Expect = 2e-09
 Identities = 67/257 26%, Positives = 125/257 48%, Gaps = 14/257 5%
Query  2    DAIKKKMVAMKMEKKNALDRAEQLEQKLRETEEA----KAKIEDDYNSLVKKNIQTENDY 57
            DA  +++  ++  +       + L   L++TEEA    +AK+     +L +  I  EN  
Sbjct  438  DA-NRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRL 496
Query  58   DNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEAS 117
               + ++++V+    RA +++Q    E++  TR     +  I + +++F +   +LE A 
Sbjct  497  REKDEEIENVRRSSARAIEELQRTLVEVE--TR----YKTEISRMKKKFESDIRELEAAL 550
Query  118  KAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLE 177
              A+ +  N + L+ + S   +R+ +LE  L E + ++++   +   A RK      +LE
Sbjct  551  DNANRA--NSEYLKQIKSLQ-QRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELE 607
Query  178  RAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAEN 237
             A A LE AE    + E +L      +  + +Q    +  +   E  +  + + L DA N
Sbjct  608  DARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAIN 667
Query  238  RATEAERTVSKLQKEVDRLEDELLTEKEKYK 268
                AE    +L  E  RL DEL  E+E YK
Sbjct  668  NQRGAEERAERLAAENGRLADELRQEQENYK 698
 Score = 44.2 bits 166,  Expect = 2e-05
 Identities = 63/248 25%, Positives = 122/248 49%, Gaps = 31/248 12%
Query  21   RAEQLEQKLRET-EEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAKYERAEKQIQ 79
            R +QL+  L E      A++E      + K  + E++       ++   A++E  E  ++
Sbjct  62   RVDQLQDSLDEQGTSTSAQME------ISK--KRESEIMKLRKDMELASAQFEATESSMR 113
Query  80   EHEQE-IQSLTRKISLLEEGIMKAEERFTTA-------SGKLEEASKAADESERNRKVLE 131
            +  QE +  L+ ++  L +   + E+   T        +G+LE  SKA    E      E
Sbjct  114  KRHQESVNDLSDQVDYLNKNKNRVEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAE 173
Query  132  NLNSGNDERIDQLEKQLTE-----AKWIAEEADKKYEEAARKLAITEVDLERAEARLEAA 186
               SG   ++D L +QL+E     ++   E  D +++   ++L      L +A ++L+A+
Sbjct  174  RSASGLKSQVDDLTRQLSELTSLKSRLTQENFDLQHQ--VQELDSNNAALGKARSQLQAS 231
Query  187  ----EAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEA 242
                + ++ D   Q   +  N+  LQ   D  + R +   ET  +L N+L    N    A
Sbjct  232  NDDLKRQLDDETRQRQNLQVNLSALQADYDNLNVRLEEEAETSTNLRNQLSKV-NADYSA 290
Query  243  ERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
             +  S++ KE+    +E+   K + +    EL+ T  +L
Sbjct  291  LK--SRFDKELALKMEEMEDLKRRMQVRITELEDTCEQL 327

Sequence Alignment: 43. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 49.7 bits 190,  Expect = 3e-07
 Identities = 75/266 28%, Positives = 140/266 52%, Gaps = 42/266 15%
Query  3    AIKKKMVAMKMEKK-----NALD-RAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTEND 56
            A K+K+ A+K  +K     + L+ + E++ + + E    K ++  +   L+K+  + +  
Sbjct  76   ANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQENTELIKEVHEVKLQ 135
Query  57   YDNCN-------TQLQDVQAKYERAEKQ---IQEH----EQEIQSLTRKISLLEEGIMKA 102
             DN N        QL+D + + E  E++   ++ H    E E++SL  ++    E  ++ 
Sbjct  136  LDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEARLEL 195
Query  103  EERFTTASG-------KLEEASKA-ADESERNRKVLENLNSGNDERID-------QLEKQ 147
            E ++T A+G       K E   +A ADE E  R+ +    S  +E+++        LEKQ
Sbjct  196  ERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQ 255
Query  148  LTEAKWIAEEADKKYEEAARKLAITE---VDLERAEARLEAAEAKVIDLEEQ----LTVV 200
             +  +   E      E+A R     E     LE+    L+    +V  L EQ    L V 
Sbjct  256  KSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVK 315
Query  201  GANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQKEVDRLEDEL 260
             A ++ LQ + ++   + D      + LT+ L +A+++  +A R + + + E+ RLE+E 
Sbjct  316  IAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENER 375
Query  261  LTEKEKYK 268
                  YK
Sbjct  376  DELSAAYK 383

Sequence Alignment: 44. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 49.9 bits 191,  Expect = 4e-07
 Identities = 65/246 26%, Positives = 130/246 52%, Gaps = 26/246 10%
Query  20   DRAEQLE-QKLRET-EEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAKYERAEKQ 77
            +R  ++E  KLR+  EE++ + ED  N L KK+     DY     QLQ   +K +R E+Q
Sbjct  90   NRKREVELSKLRKLLEESQLENEDAMNVLRKKHQDVCLDYTEQIEQLQKKNSKIDR-ERQ 148
Query  78   IQEHE-----QEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADESERNRKVLEN 132
              +HE       I  L +   + E+   K E++    S K+E+ +K  ++  + R+ L+ 
Sbjct  149  RLQHEVIELTATIDQLQKDKHVAEKMAQKFEQQTIELSNKVEDLNKHVNDLAQQRQRLQA 208
Query  133  LNSG-----NDERID---------QLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLER 178
             NS      +D+++          QL +QL E++   E+A+++  +   +L   +++L+ 
Sbjct  209  ENSDLLAEIHDQKVQLDNLQHVKYQLAQQLEESRRRLEDAERERSQMQAQLHQVQLELDS 268
Query  179  AEARLEAAEAKVIDLEEQLTVVGANIKTLQVQND-QASQREDSYEETIRDLTNRLKDAEN 237
                L+   A  ++ E +L++    I   + + D + +   +  E+  + +  +  + E 
Sbjct  269  VRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEE 328
Query  238  RATEAERTVSKLQKEVDRLEDE---LLTEKEK 266
            +     + VS+L+K   RL+ E   L+ + EK
Sbjct  329  QIEIMLQKVSQLEKAKARLQSEVEVLIVDLEK 360
 Score = 47.9 bits 182,  Expect = 2e-06
 Identities = 64/280 22%, Positives = 132/280 47%, Gaps = 15/280 5%
Query  1    MDAIKKKMVAMKMEK-KNALDRAEQLEQ----KLRETEEAK-AKIEDDYNSLVKKNIQTE 54
            M+A++K M   ++++   AL  AE   +    +LR+  +A+ A++E   ++L + N++ +
Sbjct  509  MEALRKSM-QFEIDRLTAALADAEARMKAEIARLRKKYQAEIAELEMTVDNLNRANLEAQ 567
Query  55   NDYDNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLE 114
                  + Q+  +QA  E  ++Q+Q+   +     RKIS L   + + +  +  A    +
Sbjct  568  KTIKKQSEQIIQLQANLEDTQRQLQQTLDQYALAQRKISALSAELEECKTALDNAIRARK 627
Query  115  EASKAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEV 174
            +A    +E+      L ++NS      ++LE +L+ A+   +E  K+   A  +      
Sbjct  628  QAEADLEEAHVRISDLTSINSNLTAIKNKLETELSTAQADLDEVTKELHAADERANRALA 687
Query  175  DLERAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQA-------SQREDSYEET-IR 226
            D  RA   L   +   + ++     +   +K LQVQ  +A        +R  +  ET IR
Sbjct  688  DAARAVQELHEEQEHSMKIDALRKSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIR 747
Query  227  DLTNRLKDAENRATEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAEL 281
            DL   L +   R  E +  + K  + +  ++ ++  E + +    D  D  + +L
Sbjct  748  DLEVALDEETRRHKETQSALRKKDRRIKEVQMQIDEEHKMFVMAQDTADRMLEKL 802

Sequence Alignment: 45. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 49.7 bits 190,  Expect = 4e-07
 Identities = 69/263 26%, Positives = 138/263 52%, Gaps = 29/263 11%
Query  6    KKMVAMKMEKKNALDRAEQLE-QKLR-ETEEAKAKIEDDYNSLVKKN----IQTENDYDN 59
            +K +A K E+  AL +  Q+E ++L     EA+AK++ +   L KK      + E   D 
Sbjct  497  EKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDA 556
Query  60   CNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKA 119
             N    D+Q   ++   QI E +     + R++    + +   + R      +LEE   A
Sbjct  557  ANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIA 616
Query  120  ADESERNRKVLENLNSGNDERIDQLE---------KQLTEAKWIAEEADKKYEEAARKLA 170
             +++ R ++  E L+     R+++L          K   E+++ A +AD  Y+E  ++L 
Sbjct  617  LEQASRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQAD--YDEVHKELR 674
Query  171  ITEVDLERAEARLEAAEAKVIDLEEQL----TV---VGANIKTLQVQNDQASQRE-DSYE 222
            I++  +++    L++ +  +I+ +E+L    TV   +   ++TL+V+ ++         +
Sbjct  675  ISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGK 734
Query  223  ETIRDLTNRLKDAENRATEAER----TVSKLQKEVDRLEDELLTEKEKYKAI 270
              I  L +R++D E    E  R    T   L+K+  R+++ LL  +E +K I
Sbjct  735  RVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQI 786
 Score = 49.7 bits 190,  Expect = 4e-07
 Identities = 70/265 26%, Positives = 144/265 54%, Gaps = 44/265 16%
Query  3    AIKKKMVAMKMEKK-----NALD-RAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTEND 56
            A K+K+ A+K  +K     + L+ + E++ + + E    K ++  +   L+K+  + +  
Sbjct  162  ANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHKQRLTQENTELIKEVHEVKLQ 221
Query  57   YDNCN-------TQLQDVQAKYERAEKQ---IQEH----EQEIQSLTRKISLLEEGIMKA 102
             DN N        QL+D + + E  E++   ++ H    E E++SL  ++    E  ++ 
Sbjct  222  LDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEARLEL 281
Query  103  EERFTTASGKLEE-ASKAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKK 161
            E ++T A+G      SK   E + +   +E L     ++I + E+QL          +K+
Sbjct  282  ERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQ 341
Query  162  YEEAARKLAITEVDLERAEARLEAAEAKV-------IDLEEQLTVVGANI----KTLQVQ 210
                  ++ +  +DLE+A A  +  E +V       +DL+++L  V   +    K L+++
Sbjct  342  KSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIK 401
Query  211  NDQASQREDSYEETIRD-----------LTNRLKDAENRATEAERTVSKLQKEVDRLEDE 259
              +  + +  YE+ +RD           LT+ L +A+++  +A R + + + E+ RLE+E
Sbjct  402  IGELQKLQHEYEK-VRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENE 460
Query  260  LLTEKEKYK 268
                   YK
Sbjct  461  RDELSAAYK 469

Sequence Alignment: 46. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 39.7 bits 146,  Expect = 0.0005
 Identities = 52/234 22%, Positives = 112/234 47%, Gaps = 16/234 6%
Query  3    AIKKKMVAMKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNCNT 62
            A+  ++  M++  + AL RA++  +++   EEA  ++    N L   N+   +      T
Sbjct  605  ALTAELEEMRVNLEQAL-RAKRAAEQMH--EEAVVRV----NELTTINVNLASAKSKLET 657
Query  63   QLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADE 122
            ++  +Q  Y+   K+++  ++ +Q LT ++   ++ +    ER T    KLE   K+ + 
Sbjct  658  EFSALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVT----KLETIKKSLET 713
Query  123  SERN-----RKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLE 177
              RN      +V  N  +G    I +LE ++ + +   EE  +++ E  + L   +  ++
Sbjct  714  EVRNLQIRIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVK 773
Query  178  RAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAEN 237
                + E    ++  L+E    +   +K  + Q  +           +R +   L+ AE+
Sbjct  774  ELLLQNEEDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAED 833
Query  238  RATEAERTVS 247
            RA +AE  +S
Sbjct  834  RADQAESNLS 843
 Score = 40.6 bits 150,  Expect = 0.0002
 Identities = 69/264 26%, Positives = 145/264 54%, Gaps = 46/264 17%
Query  3    AIKKKMVAMKMEKK-----NALD-RAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTEND 56
            A K K+VA K  +K     + L+ + E++ + + E    + ++  + + L+K+  + +  
Sbjct  162  ANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKIS 221
Query  57   YDNCN-------TQLQDVQAKYERAEKQ---IQEH----EQEIQSLTRKISLLEEGIMKA 102
             DN N        QL+D + + E  E++   ++ H    E E++SL  ++    E  ++ 
Sbjct  222  LDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLEL 281
Query  103  EERFTTASGKLEEAS-KAADESERNRKV--LENLNSGNDERIDQLEKQLTEAKWIAEEAD 159
            E ++T A+G  + AS K+  E+E    V  +E L     ++I +  +QL          +
Sbjct  282  ERQLTKANG--DAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALE 339
Query  160  KKYEEAARKLAITEVDLERAEARLEAAEAKV-------IDLEEQLTVVG----------- 201
            K+      ++ +  +DLE+A A  +A E +V       +DL+ +L  V            
Sbjct  340  KQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLR 399
Query  202  ---ANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQKEVDRLED 258
               A+++ LQ + ++   ++++     + L + L +A+++  +A R + + + E+ RLE+
Sbjct  400  VKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLEN 459
Query  259  ELLTEKEKYK 268
            E       YK
Sbjct  460  EREELAAAYK 469

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.