The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD
LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV
YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT
NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF
NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV
TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT
KNAGVLTCSLSKRC
Sequence Info Allergen Name Length Opt Bits Score E Value
BAB86287 Cry j 1.0103 374 2572 592.7 8.8e-171
P18632 Cry j 1.0101 374 2556 589.0 1.1e-169
BAA05543 Cry j 1.0102 374 2554 588.6 1.5e-169
AAD03609 Jun a 1.0102 367 2070 478.3 2.4e-136
P81294 Jun a 1.0101 367 2070 478.3 2.4e-136
AAF72629 Cup s 1.0105 367 2068 477.8 3.3e-136
Q9LLT1 Jun v 1.0101 367 2064 476.9 6.2e-136
AAF72628 Cup s 1.0104 367 2063 476.7 7.3e-136
AAF72626 Cup s 1.0102 367 2062 476.4 8.5e-136
Q96385 Cha o 1 375 2061 476.2 1e-135
AAF72625 Cup s 1.0101 367 2057 475.3 1.9e-135
AAF80164 Jun v 1.0102 367 2056 475.1 2.2e-135
AAF72627 Cup s 1.0103 367 2053 474.4 3.5e-135
CAC48400 Jun o 1 367 2052 474.2 4.1e-135
CAC37790 Cup a 1 367 2027 468.5 2.1e-133
Q9SCG9 Cup a 1 346 1963 453.9 4.9e-129
A0A251RNJ1 Hel a 6.0101 394 1112 259.9 1.4e-70
AY904433 Art v 6.0101 396 1094 255.8 2.5e-69
P27762 Amb a 2 397 1084 253.5 1.2e-68
P27761 Amb a 1 397 1056 247.1 1e-66
AAA32669 Amb a 1 397 1056 247.1 1e-66
P27760 Amb a 1 398 1049 245.5 3e-66
P27759 Amb a 1 396 1047 245.0 4.1e-66
P28744 Amb a 1 392 987 231.4 5.4e-62
ABM60783 Pen c 32.0101 290 268 67.6 8e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 592.7 bits 2572,  Expect = 9e-171
 Identities = 374/374 100%, Positives = 374/374 100%, Gaps = 0/374 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVLTCSLSKRC 374
            KNAGVLTCSLSKRC
Sbjct  361  KNAGVLTCSLSKRC 374

Sequence Alignment: 2. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 589.0 bits 2556,  Expect = 1e-169
 Identities = 371/374 99%, Positives = 374/374 100%, Gaps = 0/374 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCLVALLV+SFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVLSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            YIGNGGPCVFIKRVSNVIIHGL+LYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            NIWIDHNSFSNSSDGLVDVTL+STGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
Query  361  KNAGVLTCSLSKRC 374
            KNAGVLTCSLSKRC
Sbjct  361  KNAGVLTCSLSKRC 374

Sequence Alignment: 3. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 588.6 bits 2554,  Expect = 2e-169
 Identities = 371/374 99%, Positives = 373/374 99%, Gaps = 0/374 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV
Sbjct  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT
Sbjct  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVM LGHDDAYSDDKSMKVTVAF
Sbjct  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV
Sbjct  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATP+LT
Sbjct  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLT 360
Query  361  KNAGVLTCSLSKRC 374
            +NAGVLTCSLSKRC
Sbjct  361  QNAGVLTCSLSKRC 374

Sequence Alignment: 4. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 478.3 bits 2070,  Expect = 2e-136
 Identities = 289/367 78%, Positives = 331/367 90%, Gaps = 0/367 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+H L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC++ S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 5. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 478.3 bits 2070,  Expect = 2e-136
 Identities = 289/367 78%, Positives = 331/367 90%, Gaps = 0/367 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   FYTVTSTDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+H L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHSLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC++ S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESPSACANWVWRSTRDAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 6. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 477.8 bits 2068,  Expect = 3e-136
 Identities = 288/366 78%, Positives = 331/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLGNVL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL+STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSF APNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC ++S+C+NWVW+ST+D F NGAYFVSSGK E  NIYT  EAF VENGN  PQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 7. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 476.9 bits 2064,  Expect = 6e-136
 Identities = 288/366 78%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GV PVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 8. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 476.7 bits 2063,  Expect = 7e-136
 Identities = 287/366 78%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLGNVL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL+STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSF APNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC ++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGN  PQLT
Sbjct  301  TKRIGCVSTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 9. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 476.4 bits 2062,  Expect = 9e-136
 Identities = 286/366 78%, Positives = 332/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKL+MP+Y+AG+KT DGRGA V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL+STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGN  PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 10. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 476.2 bits 2061,  Expect = 1e-135
 Identities = 295/374 78%, Positives = 332/374 88%, Gaps = 0/374 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M S  L+A+LVF   I SCFSDNPIDSCWRGD+NW QNRMKLADCAVGFGSS MGGKGG 
Sbjct  1    MASCTLLAVLVFLCAIVSCFSDNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGA 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+SDDDPVNPAPGTLRYGATR+R LWIIFS N+NIKL MP+YIAG KT DGRGA+V
Sbjct  61   FYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            +IGNGGPC+F++ VS+VI+HGL ++GC+TSV GNVLI+E+ GV PVH QDGDA+T+R  T
Sbjct  121  HIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            ++WIDHNS+S+SSDGLVDVTL STGVTISNN FFNHHKVMLLGH D YSDDKSMKVTVAF
Sbjct  181  DVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGL+HVANNNYDPW+IYAIGGSSNPTILSEGNSFTAPN+S KK+V
Sbjct  241  NQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T R+GC++ S+C+NWVW+STQD F NGAYFVSSGK EG NIY   EAF VENG+A PQLT
Sbjct  301  TRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLT 360
Query  361  KNAGVLTCSLSKRC 374
            KNAGVLTC LSK C
Sbjct  361  KNAGVLTCILSKPC 374

Sequence Alignment: 11. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 475.3 bits 2057,  Expect = 2e-135
 Identities = 285/366 77%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YT T+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   IYTATSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL+STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSF APNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGN  PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 12. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 475.1 bits 2056,  Expect = 2e-135
 Identities = 287/366 78%, Positives = 329/366 89%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL+A+LVF   I SC SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MASPCLIAFLVFLCAIVSCCSDNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT++DD+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   FYTVTSADDNPVNPTPGTLRYGATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GV PVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TI NN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 13. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 474.4 bits 2053,  Expect = 4e-135
 Identities = 285/366 77%, Positives = 330/366 90%, Gaps = 0/366 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            MDSPCL+A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADCAVGFGSSTMGGKGGD
Sbjct  1    MDSPCLIAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGD 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   IYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++ C+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+ + SDGL+DVTL+STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAF
Sbjct  181  NAWIDHNSLPDCSDGLIDVTLSSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAPNE+YKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGN  PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLT 360
Query  361  KNAGVL 366
            KNAGV+
Sbjct  361  KNAGVV 366

Sequence Alignment: 14. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 474.2 bits 2052,  Expect = 4e-135
 Identities = 286/367 77%, Positives = 331/367 90%, Gaps = 0/367 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCL A+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG+
Sbjct  1    MASPCLRAVLVFLCAIVSCYSDNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGE 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+++D+PVNP PGTLRYGATR++ LWIIFS NMNIKLKMP+Y+AG+KT DGRGA V
Sbjct  61   FYTVTSAEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F+++VS+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRKVSHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y +DKSMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYDPW IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ST+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESTSACANWVWRSTRDAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            KNAGV+T
Sbjct  361  KNAGVVT 367

Sequence Alignment: 15. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 468.5 bits 2027,  Expect = 2e-133
 Identities = 284/367 77%, Positives = 326/367 88%, Gaps = 0/367 0%
Query  1    MDSPCLVALLVFSFVIGSCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGD 60
            M SPCLVA+LVF   I SC+SDNPIDSCWRGDSNW QNRMKLADC VGFGS TMGGKGG+
Sbjct  1    MASPCLVAVLVFLCAIVSCYSDNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGE 60
Query  61   LYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQV 120
            +YTVT+SDD+PVNP PGTLRYGATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V
Sbjct  61   IYTVTSSDDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADV 120
Query  121  YIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTAT 180
            ++GNGGPC+F++  S+VI+HGL+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  T
Sbjct  121  HLGNGGPCLFMRTASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVT 180
Query  181  NIWIDHNSFSNSSDGLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAF 240
            N WIDHNS+S+ SDGL+DVTL STG+TISNN FFNHHKVMLLGHDD Y DD SMKVTVAF
Sbjct  181  NAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAF 240
Query  241  NQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQV 300
            NQFGPN GQRMPRARYGLVHVANNNYD W IYAIGGSSNPTILSEGNSFTAP+ESYKK+V
Sbjct  241  NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEV 300
Query  301  TIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLT 360
            T RIGC+++S+C+NWVW+ T+D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT
Sbjct  301  TKRIGCESTSACANWVWRFTRDAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLT 360
Query  361  KNAGVLT 367
            +NAGV+T
Sbjct  361  QNAGVVT 367

Sequence Alignment: 16. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 453.9 bits 1963,  Expect = 5e-129
 Identities = 273/345 79%, Positives = 313/345 90%, Gaps = 0/345 0%
Query  22   DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRY 81
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG++YTVT+S+D+PVNP PGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  82   GATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHG 141
            GATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V++GNGGPC+F+++ S+VI+HG
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  142  LYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTL 201
            L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  TN WIDHNS+S+ SDGL+DVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  202  TSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHV 261
             STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAFNQFGPN GQRMPRARYGLVHV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  262  ANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQ 321
            ANNNYD W IYAIGGSSNPTILSEGNSFTAPNESYKK+VT RIGC+T+S+C+NWVW+ST+
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  322  DVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVL 366
            D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT+NAGV+
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345

Sequence Alignment: 17. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 259.9 bits 1112,  Expect = 1e-70
 Identities = 173/353 49%, Positives = 222/353 62%, Gaps = 5/353 1%
Query  18   SCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTN-SDDDPVNPAP 76
            +C + N +D CWR  ++WA NR  +ADCA GF   T GGKGGD+Y VT+ +DDDP NP  
Sbjct  41   ACEAVNIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKE 100
Query  77   GTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSN 136
            GTLR+G T+ RPLWI F  +M I L   + +A  KT DGRGA+V I NGG  + +  V N
Sbjct  101  GTLRFGVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKN 158
Query  137  VIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGL 196
            +II  + ++     + G ++ +        +  DGD +T+     IWIDH SFS + DGL
Sbjct  159  IIISNINVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGL 217
Query  197  VDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARY 256
            VDVTL S+ VT+SN  F  H KVMLLG DD +  DK+M VTVAFN F  NC QRMPR R+
Sbjct  218  VDVTLGSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRF 277
Query  257  GLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWV 316
            G+ +V NNNYD W  YAIGGSS PTILS+GN F AP+++ KK V +R     S S + W 
Sbjct  278  GFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRADAPESESMT-WN 336
Query  317  WQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            W++ +DV+ NGA FV SG         +      E G   P+LT +AGVLTCS    C
Sbjct  337  WRTEKDVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVLTCSPGSPC 394

Sequence Alignment: 18. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 255.8 bits 1094,  Expect = 2e-69
 Identities = 172/350 49%, Positives = 224/350 64%, Gaps = 9/350 2%
Query  19   CFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTN-SDDDPVNPAPG 77
            C + N ID CWR  ++W +NR  LA CA GF   T GG GG++Y VT+ SDD+  NP PG
Sbjct  44   CAAHNIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPG 103
Query  78   TLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNV 137
            TLR G T+D+PLWIIF  +M IKLK  + I   KT DGRGA V I  GG  + I  V NV
Sbjct  104  TLRCGVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNV 161
Query  138  IIHGLYLYGCSTSVLGNVLINESFGVEP--VHPQDGDALTLRTATNIWIDHNSFSNSSDG 195
            IIH ++++    +  G   I ++   +P   H  DGD + +  ++ IWIDH ++S+  DG
Sbjct  162  IIHNIHIHDIKVTEGG---IIKATDAKPGHRHKSDGDGICVAGSSKIWIDHCTLSHGPDG 218
Query  196  LVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRAR 255
            L+DVTL ST VTISN  F +H+K++LLG D+++ DDK M VTVAFN+F   C QRMPR R
Sbjct  219  LIDVTLGSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCR 278
Query  256  YGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNW 315
            +G+ +V NN+Y  W  YAIGGS+NPTILS+GN F APN+  KK V +R     + S   W
Sbjct  279  FGFFQVVNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTESMK-W 337
Query  316  VWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
             W+S +D++ NGA FV+SG         K      E G+A  QLT  AG L C   K C
Sbjct  338  NWRSEKDLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTLKCVPGKPC 396

Sequence Alignment: 19. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 253.5 bits 1084,  Expect = 1e-68
 Identities = 171/352 48%, Positives = 219/352 62%, Gaps = 5/352 1%
Query  19   CFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVNPAPG 77
            C + N ID CWR   +WA+NR  L +CA GFG +T GGK GD+Y VT + DDD VNP  G
Sbjct  45   CEAHNIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEG 104
Query  78   TLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNV 137
            TLR+GAT+DRPLWIIF  +M I L+  M +   KT DGRGA+V +  GG  + +  V NV
Sbjct  105  TLRFGATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGG--ITLMNVKNV 162
Query  138  IIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLV 197
            IIH + ++       G +  N    + P H  DGDA+ +  +++IWIDH ++S S DGLV
Sbjct  163  IIHNIDIHDVRVLPGGRIKSNGGPAI-PRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGLV 221
Query  198  DVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYG 257
            DV   STGVTISN  F +H K +LLG  D +  D  M VT+A+N F     +RMPR R+G
Sbjct  222  DVNWGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFG 281
Query  258  LVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVW 317
            + ++ NN YD W  YAIGGSSNPTILS+GN F AP+  YKK V +R G +     + W W
Sbjct  282  FFQIVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEWMT-WNW 340
Query  318  QSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            ++  DV+ NGA FV+SG                E G+  PQLT NAGVLTCS    C
Sbjct  341  RTQNDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVLTCSPGAPC 397

Sequence Alignment: 20. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 247.1 bits 1056,  Expect = 1e-66
 Identities = 171/351 48%, Positives = 217/351 61%, Gaps = 9/351 2%
Query  18   SCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVNPAP 76
            +C + N ID CWRG ++W  NR  LADCA GF   T GGK GD+YTVT N DDD  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSN 136
            GTLR+ A ++RPLWIIF  +M I L   + +   KT DGRG +V I NGG  + +  V N
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQ--DGDALTLRTATNIWIDHNSFSNSSD 194
            +IIH + ++     VL   +I  + G  P+  Q  DGD + +  ++ IWIDH S+S S D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRA 254
            GLVDVTL ST VTISN  F  + K +LLG DD +  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP++  KK V  R G   + S + 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            W W+S +D++ NGA FV+SG                E G A  +LT +AGV++C     C
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCHPGAPC 397

Sequence Alignment: 21. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 247.1 bits 1056,  Expect = 1e-66
 Identities = 171/351 48%, Positives = 217/351 61%, Gaps = 9/351 2%
Query  18   SCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVNPAP 76
            +C + N ID CWRG ++W  NR  LADCA GF   T GGK GD+YTVT N DDD  NP  
Sbjct  44   ACEALNIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKE 103
Query  77   GTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSN 136
            GTLR+ A ++RPLWIIF  +M I L   + +   KT DGRG +V I NGG  + +  V N
Sbjct  104  GTLRFAAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKN 161
Query  137  VIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQ--DGDALTLRTATNIWIDHNSFSNSSD 194
            +IIH + ++     VL   +I  + G  P+  Q  DGD + +  ++ IWIDH S+S S D
Sbjct  162  IIIHNINIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFD 218
Query  195  GLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRA 254
            GLVDVTL ST VTISN  F  + K +LLG DD +  DK M  TVAFN F  N  QRMPR 
Sbjct  219  GLVDVTLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRC 278
Query  255  RYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSN 314
            R+G+ +V NNNYD W  YAIGGSS PTIL +GN F AP++  KK V  R G   + S + 
Sbjct  279  RFGFFQVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA- 337
Query  315  WVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            W W+S +D++ NGA FV+SG                E G A  +LT +AGV++C     C
Sbjct  338  WNWRSDKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGVFSCRPGAPC 397

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 245.5 bits 1049,  Expect = 3e-66
 Identities = 167/351 47%, Positives = 218/351 62%, Gaps = 9/351 2%
Query  18   SCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVT-NSDDDPVNPAP 76
            +C + N ID CWR  ++WA NR  LADCA GF   T GGK GD+YTVT + DDD  NP  
Sbjct  45   ACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKE 104
Query  77   GTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSN 136
            GTLR+ A ++RPLWIIF  NM I L   + +   KT DGRG +V I N G  + +  V N
Sbjct  105  GTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKN 162
Query  137  VIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQ--DGDALTLRTATNIWIDHNSFSNSSD 194
            +IIH + ++       G +  N+     P+  Q  DGDA+ +  ++ IWIDH S+S +SD
Sbjct  163  IIIHNINIHDIKVCPGGMIKSNDG---PPILRQQSDGDAINVAGSSQIWIDHCSLSKASD 219
Query  195  GLVDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRA 254
            GL+D+TL S+ VT+SN  F  H+ V+LLG DD +  DK M  TVAFN F  +  QRMPR 
Sbjct  220  GLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRC 279
Query  255  RYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSN 314
            R+G+ +V NNNYD W  YAIGGSS PTILS+GN F AP++  KK V  R G   + S S 
Sbjct  280  RFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMS- 338
Query  315  WVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            W W++ +D++ NGA F+ SG         K      E G A  +LT +AGVL+C     C
Sbjct  339  WNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC 398

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 245.0 bits 1047,  Expect = 4e-66
 Identities = 166/348 47%, Positives = 219/348 62%, Gaps = 5/348 1%
Query  23   NPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNS-DDDPVNPAPGTLRY 81
            N ID CWRG ++WA+NR  LADCA GFG  T+GGK GD+YTVT+  DDD  NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  82   GATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHG 141
            GA ++RPLWIIF  +M I+L   M +   KT DGRGA+V I N G    +  V NVIIH 
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  142  LYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTL 201
            + ++    +  G +  N+     P    DGDA+++  ++ IWIDH S+S S DGLVD  L
Sbjct  166  INMHDVKVNPGGLIKSNDG-PAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  202  TSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHV 261
             +T +T+SN+LF  H+ V+L+G  D   +D+ M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  262  ANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQ 321
             NNNYD W  YAIGGS++PTILS+GN F AP+E  KK V  R G + ++    W W++ +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  322  DVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            DV+ NGA FV+SG                E G +   LT +AGVL+C     C
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLSCQPGAPC 396

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 231.4 bits 987,  Expect = 5e-62
 Identities = 163/348 46%, Positives = 215/348 61%, Gaps = 10/348 2%
Query  18   SCFSDNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNS-DDDPVNPAP 76
            +C + N ID CWRG ++WA+NR  LADCA GF   T+GGK GD+YTVT+  DDD  NP  
Sbjct  44   TCGTYNIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVANPKE 103
Query  77   GTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSN 136
            GTLR+GA ++RPLWIIF+ +M I+L   + I   KT DGRGA+V I N G  ++   V N
Sbjct  104  GTLRFGAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIY--NVKN 161
Query  137  VIIHGLYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGL 196
            +IIH + ++    +  G +  ++   V P    DGDA+ +   + IWIDH S+S + DGL
Sbjct  162  IIIHNIIMHDIVVNPGGLIKSHDGPPV-PRKGSDGDAIGISGGSQIWIDHCSLSKAVDGL 220
Query  197  VDVTLTSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARY 256
            +D    ST  T+SN LF  +H+ +LL  D    D++ M  TVAFN+F  N  QRMP  R+
Sbjct  221  IDAKHGSTHFTVSNCLF-TQHQYLLLFWD---FDERGMLCTVAFNKFTDNVDQRMPNLRH 276
Query  257  GLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWV 316
            G+V+V NNNY+ W  YA+GGS+ PTILS+GN F A +   KK+V  R G    S   NW 
Sbjct  277  GFVQVVNNNYERWGSYALGGSAGPTILSQGNRFLASD--IKKEVVGRYGESAMSESINWN 334
Query  317  WQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC 374
            W+S  DVF NGA FV SG                E G A  +LT +AGVL+C     C
Sbjct  335  WRSYMDVFENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLSCQPGAPC 392

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 67.6 bits 268,  Expect = 8e-13
 Identities = 72/217 33%, Positives = 113/217 52%, Gaps = 43/217 19%
Query  42   LADCAVGFGS---STMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMN 98
            + D A G+ S    T GG GG   TV++            +    + D    +  SG ++
Sbjct  1    VGDVATGYASENGGTTGGSGGTTTTVSSY---------AAFTEAVSGDDAKVVFVSGKIS 51
Query  99   IKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLYLYGCSTSVLGNVLIN 158
                        KT D    Q  +G+      I + SN I+ G   +G       NV+I 
Sbjct  52   ------------KTAD----QARVGSNTS--IIGKDSNAILSG---FGVLVKEASNVII- 89
Query  159  ESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSD-------GLVDVTLTSTGVTISNN 211
             ++GVE V   +GDA+ ++ + N+W+DH   S+  D       GL+D+T  +  VT+SN 
Sbjct  90   RNLGVEKVLADNGDAIGIQKSNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNT 149
Query  212  LFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQ-FGPNCGQRMPRARYGLVHVANNNYDPWT 270
               +H K  L+GH D+  D+    + V +N  +  N   R P  R+G  HV N+ Y   +
Sbjct  150  SIHDHWKACLIGHSDSNGDEDKGHLHVTLNNNYWYNINSRGPSFRFGTGHVYNSYYLDMS 209
Query  271  IYAIGGSSNPTILSEGNSFT 290
               I        L E N+F+
Sbjct  210  -DGINTRQGAQHLVESNTFS 228

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.