The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MDYGSDINVVRKVSRTYNVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELN
FRVDQLQDSLDEQGTSTSAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESV
NDLSDQVDYLNKNKNRVEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLK
SQVDDLTRQLSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLD
DETRQRQNLQVNLSALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELA
LKMEEMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ
DLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQR
ENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLAS
AQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE
SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV
ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS
DLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEE
AEAFATKEGRRLVAKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERR
QLAELASLNDQLQLRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQT
VRRARSMSVTREITRVIKV
Sequence Info Allergen Name Length Opt Bits Score E Value
QPB41107 Rap v 2.0101 859 5210 1193.7 0
AAO73464 Der p 11 875 1759 407.0 3.7e-114
AAF72796 Ani s 2 869 1711 396.1 7.2e-111
AAM83103 Blo t 11 875 1694 392.2 1.1e-109
AAK39511 Der f 11.0101 692 1459 338.7 1.1e-93
AAG08989 Mim n 1 284 258 65.2 9.5e-12
APG42675 Hal l 1.0101 284 246 62.5 6.3e-11
AAG08987 Hal d 1 284 245 62.2 7.4e-11
AVD53650 Sac g 1.0101 284 237 60.4 2.6e-10
CAB38044 Hel as 1 284 226 57.9 1.5e-09
AAG08988 Per v 1 284 225 57.7 1.7e-09
AAT40866 Tyr p 10.0101 284 222 57.0 2.8e-09
Q9NFZ4 Lep d 10 284 217 55.8 6.2e-09
O18416 Der p 10 284 214 55.2 9.9e-09
Q17H75 Aed a 10.0101 285 214 55.2 9.9e-09
O44119 Hom a 1.0101 284 213 54.9 1.2e-08
AEX31649 Cho a 10.0101 284 213 54.9 1.2e-08
ACN32322 Asc l 3.0101 287 211 54.5 1.6e-08
AAD19606 Per a 7.0102 284 210 54.2 1.9e-08
ABU97466 Blo t 10.0101 284 210 54.2 1.9e-08
AAF72534 Bla g 7.0101 284 210 54.2 1.9e-08
Q9NAS5 Ani s 3 284 210 54.2 1.9e-08
NP_001103782 Bomb m 3.0101 285 210 54.2 1.9e-08
Q9UB83 Per a 7 284 208 53.8 2.6e-08
A7L5V2 Scy p 1.0101 284 206 53.3 3.5e-08
BAA04557 Der f 10.0101 299 206 53.3 3.8e-08
AAK96889 Cra g 1 233 203 52.8 4.3e-08
P02538 Hom s 5 564 210 54.0 4.4e-08
Q25456 Met e 1 274 204 52.9 4.6e-08
C0LU07 Pro c 1.0101 284 203 52.6 5.6e-08
AAC48288 Hom a 1.0102 284 202 52.4 6.6e-08
CBY17558 Pan b 1.0101 284 202 52.4 6.6e-08
D3XNR9 Mac r 1.0101 284 201 52.2 7.7e-08
EU410072 Lit v 1.0101 284 200 52.0 9e-08
M1H607 Por p 1.0101 284 200 52.0 9e-08
11893851 Pen a 1 284 200 52.0 9e-08
AAX37288 Pen m 1 284 200 52.0 9e-08
O61379 Pan s 1 274 197 51.3 1.4e-07
NP_001117128 Sal s 4.0101 284 196 51.1 1.7e-07
CAA09938 Chi k 10 285 193 50.4 2.7e-07
M4M2H6 Mel l 1.0101 284 187 49.0 7e-07
XP_026775428 Pan h 4.0201 284 187 49.0 7e-07
AGM32377.1 Copt f 7.0101 256 184 48.4 9.8e-07
Q9N2R3 Cha f 1 264 174 46.1 5e-06
XP_026781482 Pan h 4.0101 284 169 44.9 1.2e-05
Q17H80 Aed a 10.0201 284 155 41.7 0.00011
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 1193.7 bits 5210,  Expect = 0
 Identities = 859/859 100%, Positives = 859/859 100%, Gaps = 0/859 0%
Query  1    MDYGSDINVVRKVSRTYNVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELN 60
            MDYGSDINVVRKVSRTYNVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELN
Sbjct  1    MDYGSDINVVRKVSRTYNVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELN 60
Query  61   FRVDQLQDSLDEQGTSTSAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESV 120
            FRVDQLQDSLDEQGTSTSAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESV
Sbjct  61   FRVDQLQDSLDEQGTSTSAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESV 120
Query  121  NDLSDQVDYLNKNKNRVEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLK 180
            NDLSDQVDYLNKNKNRVEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLK
Sbjct  121  NDLSDQVDYLNKNKNRVEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLK 180
Query  181  SQVDDLTRQLSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLD 240
            SQVDDLTRQLSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLD
Sbjct  181  SQVDDLTRQLSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLD 240
Query  241  DETRQRQNLQVNLSALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELA 300
            DETRQRQNLQVNLSALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELA
Sbjct  241  DETRQRQNLQVNLSALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELA 300
Query  301  LKMEEMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ 360
            LKMEEMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ
Sbjct  301  LKMEEMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ 360
Query  361  DLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQR 420
            DLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQR
Sbjct  361  DLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQR 420
Query  421  ENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLAS 480
            ENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLAS
Sbjct  421  ENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLAS 480
Query  481  AQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE 540
            AQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE
Sbjct  481  AQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE 540
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
            SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV
Sbjct  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS 660
            ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS
Sbjct  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS 660
Query  661  DLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEE 720
            DLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEE
Sbjct  661  DLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEE 720
Query  721  AEAFATKEGRRLVAKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERR 780
            AEAFATKEGRRLVAKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERR
Sbjct  721  AEAFATKEGRRLVAKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERR 780
Query  781  QLAELASLNDQLQLRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQT 840
            QLAELASLNDQLQLRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQT
Sbjct  781  QLAELASLNDQLQLRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQT 840
Query  841  VRRARSMSVTREITRVIKV 859
            VRRARSMSVTREITRVIKV
Sbjct  841  VRRARSMSVTREITRVIKV 859

Sequence Alignment: 2. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 407.0 bits 1759,  Expect = 4e-114
 Identities = 314/834 37%, Positives = 500/834 59%, Gaps = 5/834 0%
Query  18   NVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELNFRVDQLQDSLDEQGTST 77
            +V  G+      RLE +IR L D L+SER+ R R E+  AEL  +V  L + L+E   S+
Sbjct  22   SVEYGTDLGALTRLEDKIRLLSDDLESEREMRQRIEREKAELQIQVMSLSERLEEAEGSS 81
Query  78   SAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRV 137
             +  E++KKR+SE+ KLRK +E    + E T   +R++HQ +V+++ DQ+D L K KN+ 
Sbjct  82   ESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAVHEMQDQLDQLQKAKNKS 141
Query  138  EKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLK 197
            +KEKQ +  E+  L  QLE+ +K K T    V+  E +   L  +++++ R + ELTS K
Sbjct  142  DKEKQKFQAEVFELLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHK 201
Query  198  SRLTQENFDLQHQVQE--LDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSA 255
             RLTQEN +L  +V+E  L  +NA     + Q+    +D + +L++E R+R +L+ +   
Sbjct  202  QRLTQENTELIKEVHEVKLQLDNA--NHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHT 259
Query  256  LQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQV 315
            L+ + ++L V+L++E+E    L  QL+K N D ++ KS+++ EL    +E+E+L+R+M  
Sbjct  260  LEVELESLKVQLDDESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQ 319
Query  316  RITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENENAG 375
            +I+E E+  E L  K SSLEK K++L +E++ + ++LE      Q L KR  QLE  N  
Sbjct  320  KISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLD 379
Query  376  LQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLA 435
            L+ ++EE+T      + E  +   ++QKL+    ++ ++ D L RENK L+D L EA   
Sbjct  380  LKDKLEEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRDQLARENKKLTDDLAEAKSQ 439
Query  436  LKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENR 495
            L DA+R + +      +LE ERD L+AA K+ E   +  EAK     A L Q++ D E R
Sbjct  440  LNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKR 499
Query  496  LREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANR 555
            L +KDEEIE +R+     IE+L   L E E + KTEI+R+KKK+++ I ELE +LD AN+
Sbjct  500  LAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANK 559
Query  556  ANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEG 615
            AN +  K IK    ++ EL+   +E  R      +QLGV +R+  AL  ELE+ R  LE 
Sbjct  560  ANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQ 619
Query  616  AERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEER 675
            A RA++ AE    +   R++E+T    +L + K +LE+++SA+Q+D D+     R ++ER
Sbjct  620  ASRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDER 679
Query  676  AERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLVAK 735
             ++L  E     D L +EQE     E+++K LE E+R + +R+EE EA A   G+R++AK
Sbjct  680  VQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAK 739
Query  736  LQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERRQLAELASLNDQLQLR 795
            L+ R+RD+E E+E E RR  E+    RK +   KEL+ Q EE+ +Q+  L  + D+L  +
Sbjct  740  LESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMTDKLNEK 799
Query  796  IKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQTVR-RARSMSVTREI 853
            +K YKRQ++E E ++   + + R+ Q  ++ A+ RAD AE NL  +R + RS   T ++
Sbjct  800  VKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNLSFIRAKHRSWVTTSQV 858

Sequence Alignment: 3. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 396.1 bits 1711,  Expect = 7e-111
 Identities = 292/813 35%, Positives = 485/813 59%, Gaps = 0/813 0%
Query  30   RLESRIRELEDALDSERDGRVRAEKMVAELNFRVDQLQDSLDEQGTSTSAQMEISKKRES 89
            RLE +IR L+D ++SER+ R R E+  A+L+ ++  L D L +   +T +Q+E ++KRE 
Sbjct  36   RLEDKIRLLQDDFESERELRNRIERERADLSVQLIALTDRLQDAECATDSQIESNRKREV 95
Query  90   EIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKEKQTLVVELD 149
            E+ KLRK +E +  + E   + +RK+HQ+   D ++Q++ L K  +++++E+Q L  E+ 
Sbjct  96   ELSKLRKLLEESQLENEDAMNVLRKKHQDVCLDYTEQIEQLQKKNSKIDRERQRLQHEVI 155
Query  150  GLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLKSRLTQENFDLQH 209
             LT  ++ + K K   E      E+    L ++V+DL +++++L   + RL  EN DL  
Sbjct  156  ELTATIDQLQKDKHVAEKMAQKFEQQTIELSNKVEDLNKHVNDLAQQRQRLQAENSDLLA 215
Query  210  QVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSALQADYDNLNVRLEE 269
            ++++       L   + QL    ++ +R+L+D  R+R  +Q  L  +Q + D++ V L+E
Sbjct  216  EIHDQKVQLDNLQHVKYQLAQQLEESRRRLEDAERERSQMQAQLHQVQLELDSVRVALDE 275
Query  270  EAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQVRITELEDTCEQLRV 329
            E+       ++LS  N + +  KS+FD E+AL  EE+EDL+++M  +  E E+  E +  
Sbjct  276  ESAARVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQ 335
Query  330  KNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENENAGLQRRIEELTGENNT 389
            K S LEKAK +L +E++ + ++LE  Q  +  L +   QLE +   ++ RI+EL  E   
Sbjct  336  KVSQLEKAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLEKQVLEMKSRIDELLVELEA 395
Query  390  LRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQL 449
             + E      ++QK++    +  E+ + L RENK L D L EAN AL DANR+L +L   
Sbjct  396  AQREARAALAELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEALADANRKLHELDLE 455
Query  450  RSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRS 509
             ++L  E   L  ALK++E A RDAEA+   A A L Q++I+ME RL+EK+EE+E +R+S
Sbjct  456  NARLAGEIRDLQVALKESEAARRDAEARAQRALAELQQVRIEMERRLQEKEEEMEALRKS 515
Query  510  SARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQ 569
                I+ L   L + E R K EI+R++KK++++I ELE  +DN NRAN E  K IK   +
Sbjct  516  MQFEIDRLTAALADAEARMKAEIARLRKKYQAEIAELEMTVDNLNRANLEAQKTIKKQSE 575
Query  570  RVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELAD 629
            ++ +L+  LE+ +R      +Q  +A+RK  AL+ ELE+ +  L+ A RARK AE +L +
Sbjct  576  QIIQLQANLEDTQRQLQQTLDQYALAQRKISALSAELEECKTALDNAIRARKQAEADLEE 635
Query  630  TSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAERLAAENGRLADE 689
               R+S++T   ++LT  K +LE +LS  Q+DLD+       A+ERA R  A+  R   E
Sbjct  636  AHVRISDLTSINSNLTAIKNKLETELSTAQADLDEVTKELHAADERANRALADAARAVQE 695
Query  690  LRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELEN 749
            L +EQE+    ++LRK LE +++++ ++++EAEA A   G+R++AKL+ R+RDLE  L+ 
Sbjct  696  LHEEQEHSMKIDALRKSLEEQVKQLQVQIQEAEAAALLGGKRVIAKLETRIRDLEVALDE 755
Query  750  EARRVRESVANQRKAERLHKELVAQTEEERRQLAELASLNDQLQLRIKTYKRQLEEAEDV 809
            E RR +E+ +  RK +R  KE+  Q +EE + +       D++  ++   KRQL EAE +
Sbjct  756  ETRRHKETQSALRKKDRRIKEVQMQIDEEHKMFVMAQDTADRMLEKLNIQKRQLGEAEAM 815
Query  810  ASLTMNKYRKAQALIDEADARADAAEKNLQTVR 842
                + + R+ Q  +++A+ RAD AE +L  +R
Sbjct  816  TMQNLQRVRRYQRELEDAEGRADQAESSLNLIR 848

Sequence Alignment: 4. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 392.2 bits 1694,  Expect = 1e-109
 Identities = 299/832 35%, Positives = 495/832 59%, Gaps = 9/832 1%
Query  18   NVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELNFRVDQLQDSLDEQGTST 77
            ++  G+      RLE +IR L + L+SER+ R R E+  +++  ++  L + L+E   S+
Sbjct  22   SIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREKSDITVQLMNLTERLEETEGSS 81
Query  78   SAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRV 137
             +  E++KKR+SE+ KLRK +E    + E T   +R++HQ ++ ++ DQ+D + K KN+ 
Sbjct  82   ESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKS 141
Query  138  EKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLK 197
            +KEKQ +  E+  L  Q+E+ +K K   +  V+  E +   L  +++++ R + E+T+ +
Sbjct  142  DKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHR 201
Query  198  SRLTQENFDLQHQVQE----LDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNL 253
             RL+QEN +L  +V+E    LD+ N   G+   QL    +D + +L+DE R+R +L+ + 
Sbjct  202  QRLSQENSELIKEVHEYKISLDNANHLKGQIAQQL----EDTRHRLEDEERKRSSLENHA 257
Query  254  SALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRM 313
              L+ + ++L V+LEEE+E    L  QL+K N D ++ KS+++ EL   ++E+E+L+R+M
Sbjct  258  HTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKM 317
Query  314  QVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENEN 373
              +I+E  +  E L  K S+LEK K +L +E++ + ++LE      Q L KR  QLE  N
Sbjct  318  AQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKIN 377
Query  374  AGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREAN 433
              L+ ++EE++      + +  +   D+QKL+    +L ++ + L RENK L+D L EA 
Sbjct  378  LDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAK 437
Query  434  LALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDME 493
              L DA+R + +      +LE ER+ LAAA K+ E   +  EAK     A L Q + D E
Sbjct  438  SQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYE 497
Query  494  NRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNA 553
             RL +K+EEIE +R+     IE+L   L E E + KTE++R+KKK+++ I ELE +LD A
Sbjct  498  KRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLDAA 557
Query  554  NRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALL 613
            N+AN +  K IK    ++  L+   +E  R      +QLGV +R+  AL  ELE+ R  L
Sbjct  558  NKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNL 617
Query  614  EGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAE 673
            E A RA++ AE    +   R++E+T    +L + K +LE ++SA+Q+D D+     R ++
Sbjct  618  EQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQNDYDEVHKELRISD 677
Query  674  ERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLV 733
            ER ++L  E     D L  E E     E+++K LE E+R + IR+EE EA A   G+R++
Sbjct  678  ERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRVI 737
Query  734  AKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERRQLAELASLNDQLQ 793
            AKL+ R+RD+E E+E E RR  E+    RK +   KEL+ Q EE+ +Q+  L  ++D+L 
Sbjct  738  AKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMSDKLN 797
Query  794  LRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQTVR-RARSMSVTRE 852
             ++K YKRQ++E E ++   + + R+ Q  ++ A+ RAD AE NL  +R + RS   T +
Sbjct  798  EKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNLSFIRAKHRSWVTTSQ 857
Query  853  I 853
            +
Sbjct  858  V 858

Sequence Alignment: 5. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 338.7 bits 1459,  Expect = 1e-93
 Identities = 259/692 37%, Positives = 413/692 59%, Gaps = 0/692 0%
Query  83   ISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRVEKEKQ 142
            ++KKR+SE+ KLRK +E    + E T   +R++HQ ++ ++ DQ+D L K KN+ +KEKQ
Sbjct  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
Query  143  TLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLKSRLTQ 202
             +  E+  L  QLE+ +K K T    V+  E +   L  +++++ R + ELTS K RL+Q
Sbjct  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
Query  203  ENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNLSALQADYDN 262
            EN +L  +V+E+          ++Q+    +D + +L++E R+R +L+ +   L+ + ++
Sbjct  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
Query  263  LNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRMQVRITELED 322
            L V+L+EE+E    L  QL+K N D ++ KS+++ EL    +E+E+L+R+M  +I+E E+
Sbjct  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
Query  323  TCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENENAGLQRRIEE 382
              E L  K SSLEK K++L +E++ + ++LE      Q L KR  QLE  N  L+ ++EE
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  383  LTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRE 442
            +T      + E  +   ++QKL+    +L ++ D L RENK L+D L EA   L DA+R 
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
Query  443  LADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEE 502
            + +      +LE ERD L+AA K+ E   +  EAK     A L Q++ D E RL +KDEE
Sbjct  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
Query  503  IENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLK 562
            IE +R+     IE+L   L E E + KTEI+R+KKK+++ I ELE +LD AN+AN +  K
Sbjct  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
Query  563  QIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKN 622
             IK    ++ EL+   +E  R      +QLGV +R+  AL  ELE+ R  LE A RA++ 
Sbjct  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
Query  623  AETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAERLAAE 682
            AE    +   R++E+T    +L + K +LE+++SA+Q+D D+     R ++ER ++L  E
Sbjct  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
Query  683  NGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLVAKLQVRVRD 742
                 D L +EQE     E+++K LE E+R + +R+EE EA A   G+R++AKL+ R+RD
Sbjct  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
Query  743  LEAELENEARRVRESVANQRKAERLHKELVAQ 774
            +E E+E E RR  E+    RK +   KEL+ Q
Sbjct  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692

Sequence Alignment: 6. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 65.2 bits 258,  Expect = 9e-12
 Identities = 76/274 27%, Positives = 130/274 47%, Gaps = 17/274 6%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K  +RE A  + L  Q+E +      A    EE + + + KL + +   +
Sbjct  2    DAIKKKMQAMK-VDRENA--QDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYD 58
Query  487  QLKIDMENRLREKDEEIENVRRSSARA---IEELQRTLVEVETRYKTEISRMKKKFESDI 543
             +      +L+E + ++EN  +   +    +  LQR L  +E  Y+    R ++K+ S  
Sbjct  59   TV----NEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYE----RSEEKLNSTT 110
Query  544  RELEAALDNANRA--NSEYLK-QIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
             +LE A   A+ +  N + L+ +  S ++R+ ELE  LE  + V+ D  +++  A RK  
Sbjct  111  EKLEEASKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLA 170
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS 660
                +LE A   LE A+      E EL      +  + +Q    +  +   E  +  +  
Sbjct  171  ITEVDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTK 230
Query  661  DLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEI 711
             L DA N    AE +  +L  E  RL DEL  E+E YK       Q   EI
Sbjct  231  SLKDAENRATEAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281

Sequence Alignment: 7. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 62.5 bits 246,  Expect = 6e-11
 Identities = 73/253 28%, Positives = 126/253 49%, Gaps = 24/253 9%
Query  453  LEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLK---IDMENRLREKDEEIENVR-- 507
            ++ E+++     +  E+ LRD E + A  +  LN L+    ++EN +   +E+++     
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMTK 70
Query  508  -RSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAA---LDNANRANSEYLKQ 563
              +S + + E+++  V   TR   +I+ +++ +E +   L+ A   L+ A++A  E  + 
Sbjct  71   LETSEKRVTEMEQE-VSGTTR---KITLLEEDLERNEERLQTATERLEEASKAADESERG 126
Query  564  IKSLQ-------QRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGA 616
             K L+       +R+ +LE  L+E + +++D   +   A RK      +LE A A LE A
Sbjct  127  RKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAA 186
Query  617  ERARKNAETELADTSTRLS--EITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEE 674
            E      E EL      +   EI+ Q  S   D    E  +  +   L DA N    AE 
Sbjct  187  EAKILELEEELKVVGNNMKSLEISEQEASQREDS--YEETIRDLTQRLKDAENRATEAER 244
Query  675  RAERLAAENGRLADELRQEQENYKNAESLRKQLEVEI 711
               +L  E  RL DEL  E+E YK       Q   E+
Sbjct  245  TVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 8. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 62.2 bits 245,  Expect = 7e-11
 Identities = 71/256 27%, Positives = 122/256 47%, Gaps = 18/256 7%
Query  453  LEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSAR 512
            ++ E+++     +  E+ LRD E + A  +  LN L+    N   + D   E ++ + A+
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMAK 70
Query  513  AIEELQRTLVEVETRYK---TEISRMKKKFESDIRELEAA---LDNANRANSEYLKQIKS 566
             +E  ++ + E+E        +I+ +++ +E +   L+ A   L+ A++A  E  +  + 
Sbjct  71   -LETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADESERGARV 129
Query  567  LQ-------QRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERA 619
            L+       +R+ +LE  L+E + +++D   +   A RK      +LE A A LE AE  
Sbjct  130  LESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAK 189
Query  620  RKNAETELADTSTRLS--EITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE 677
                E EL      +   EI+ Q  S   D    E  +  +   L DA N    AE    
Sbjct  190  ILELEEELKVVGNNMKSLEISEQEASQREDS--YEETIRDLTQRLKDAENRATEAERTVS 247
Query  678  RLAAENGRLADELRQEQENYKNAESLRKQLEVEI 711
            +L  E  RL DEL  E+E YK       Q   E+
Sbjct  248  KLQKEVDRLEDELLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 9. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 60.4 bits 237,  Expect = 3e-10
 Identities = 68/274 24%, Positives = 118/274 43%, Gaps = 9/274 3%
Query  436  LKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLK--IDME 493
            +    +++  ++  +   +   + L   L+DTEE     E  L + Q   + L+   D+ 
Sbjct  1    MDSIKKKMIAMKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIV 60
Query  494  NRLRE----KDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAA 549
            N   +    K EE E     S + I+ L R +  +E   +    R++   E  + E   A
Sbjct  61   NEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEK-LEEASKA 119
Query  550  LDNANRANSEYLKQIKSL-QQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELED 608
             D + R N + L+ + +  ++R   LE  L E + ++++   +   A RK      +LE 
Sbjct  120  ADESER-NRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLER 178
Query  609  ARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINN 668
            A A LE AE    + E +L+     +  + +Q    +  +   E  +  +   L DA N 
Sbjct  179  AEARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENR 238
Query  669  QRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEI 711
               AE    +L  E  RL DEL  E+E YK       Q   E+
Sbjct  239  ATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 281

Sequence Alignment: 10. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 57.9 bits 226,  Expect = 1e-09
 Identities = 90/255 35%, Positives = 140/255 54%, Gaps = 50/255 19%
Query  297  KELALKMEEMEDLKRRMQVRITELEDT-CEQLRVKN--SSLEKAKTKLANEIKEITIELE 353
            K LA+KME+   L R  QV   +L D  C + +V+   ++L+K    L N+   I  +L 
Sbjct  7    KMLAMKMEKENALDRAEQVE-QKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLL 65
Query  354  NTQIIVQDLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTE 413
            +    ++   K+N ++E+E AGLQRRI+              LLE+D+++   S   L  
Sbjct  66   DANTKLEASEKKNAEIESETAGLQRRIQ--------------LLEEDLER---SEERLQS 108
Query  414  RNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRD 473
              + L+  +K  +D+       L+  +R LAD  +L        D L A LK+ +    D
Sbjct  109  ATEKLEEASKA-ADESERGRKVLE--SRSLADDERL--------DGLEAQLKEAKYIAED 157
Query  474  AEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT--- 530
            AE K+  A   L   ++D+E R   + E  E         I EL+  L  V    K+   
Sbjct  158  AERKFDEAARKLAITEVDLE-RAEARLEAAEA-------KILELEEELKVVGNNMKSLEI 209
Query  531  ---EISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET-LLEEERR--- 583
               E S+ +  +E  IR+L   L +A    SE  + +  LQ+ V  LE  LL E+ R   
Sbjct  210  SEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQKEVDRLEDELLAEKERYKA 269
Query  584  VSDDL 588
             SD+L
Sbjct  270  TSDEL 274

Sequence Alignment: 11. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 57.7 bits 225,  Expect = 2e-09
 Identities = 67/257 26%, Positives = 125/257 48%, Gaps = 14/257 5%
Query  438  DA-NRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRL 496
            DA  +++  ++  +       + L   L++TEE    A+AK+     +L +  I  EN  
Sbjct  2    DAIKKKMVAMKMEKKNALDRAEQLEQKLRETEE----AKAKIEDDYNSLVKKNIQTENDY 57
Query  497  REKDEEIENVRRSSARAIEELQRTLVEVE--TR----YKTEISRMKKKFESDIRELEAAL 550
               + ++++V+    RA +++Q    E++  TR     +  I + +++F +   +LE A 
Sbjct  58   DNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEAS 117
Query  551  DNANRA--NSEYLKQIKSLQ-QRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELE 607
              A+ +  N + L+ + S   +R+ +LE  L E + ++++   +   A RK      +LE
Sbjct  118  KAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLE 177
Query  608  DARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAIN 667
             A A LE AE    + E +L      +  + +Q    +  +   E  +  + + L DA N
Sbjct  178  RAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAEN 237
Query  668  NQRGAEERAERLAAENGRLADELRQEQENYK 698
                AE    +L  E  RL DEL  E+E YK
Sbjct  238  RATEAERTVSKLQKEVDRLEDELLTEKEKYK 268

Sequence Alignment: 12. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 57.0 bits 222,  Expect = 3e-09
 Identities = 76/267 28%, Positives = 148/267 55%, Gaps = 36/267 13%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKD--TEEALRDAEAKLASAQAA 484
            D ++    A+K       D    R+++ AE+ +  A LK   TEE +R  + K+   +  
Sbjct  2    DAIKNKMQAMKLEEDNAID----RAEI-AEQKARDANLKSEKTEEEVRALQKKIQQIENE 56
Query  485  LNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
            L+Q++ ++  +   K EE E   +++   +  L R +  +E     ++ R +++++    
Sbjct  57   LDQVQENL-TQATTKLEEKEKALQTAEADVAALNRRIQLIE----EDLERSEERLKVATA 111
Query  545  ELEAALDNANRANSEYLKQI---KSL--QQRVKELETLLEEERRVSDDLRNQLGVAERKR 599
            +LE A  +A+   SE ++++   +S+  ++R+  LE+ L+E R +++D       A+RK 
Sbjct  112  KLEEASHSAD--ESERMRKMLEHRSITDEERMDGLESQLKEARLMAED-------ADRKY 162
Query  600  VALAQELEDARALLEGAERARKNAETELADTSTRLSEI-----TLQVTSLTNDKRR--LE 652
              +A++L    A LE AE   +  E+++ +    L  +     +L+V+     +R    E
Sbjct  163  DEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYE 222
Query  653  ADLSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIR 712
              +  M S L +A      AE   ++L  E  RL DEL +E+E Y   ES+  +L+    
Sbjct  223  QQIRIMTSKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKY---ESISDELDQTFA 279
Query  713  EIT 715
            E+T
Sbjct  280  ELT 282

Sequence Alignment: 13. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 55.8 bits 217,  Expect = 6e-09
 Identities = 67/249 26%, Positives = 126/249 50%, Gaps = 21/249 8%
Query  455  AERDSLAAALK--DTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSAR 512
            AE+ S  A L+   +EE +R  + K+   +  L+Q++  +  +   K EE E   +++  
Sbjct  25   AEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESL-TQANTKLEEKEKSLQTAEG 83
Query  513  AIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVK 572
             +  L R +  +E   +    R+K    S + E   + D + R       +  + ++R++
Sbjct  84   DVAALNRRIQLIEEDLERSEGRLKIA-TSKLEEASQSADESERMRKMLEHRSITDEERME 142
Query  573  ELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTST 632
             LE+ L+E R +++D       A+RK   +A++L    A LE AE   +  E+++ +   
Sbjct  143  GLESQLKEARMMAED-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEE 195
Query  633  RLSEI-----TLQVTSLTNDKRR--LEADLSAMQSDLDDAINNQRGAEERAERLAAENGR 685
             L  +     +L+V+     +R    E  +  M + L +A      AE   ++L  E  R
Sbjct  196  ELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQKEVDR 255
Query  686  LADELRQEQENYKNAESLRKQLEVEIREIT 715
            L DEL +E+E YK   S+  +L+    E+T
Sbjct  256  LEDELVHEKEKYK---SISDELDQTFAELT 282

Sequence Alignment: 14. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 55.2 bits 214,  Expect = 1e-08
 Identities = 76/266 28%, Positives = 151/266 56%, Gaps = 41/266 15%
Query  421  ENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLAS 480
            +NK  + +L + N A+  A  E+A+ +   + L AE+         +EE +R  + K+  
Sbjct  5    KNKMQAMKLEKDN-AIDRA--EIAEQKARDANLRAEK---------SEEEVRALQKKIQQ 52
Query  481  AQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE 540
             +  L+Q++ +  +    K EE E   +++   +  L R +  +E     ++ R +++++
Sbjct  53   IENELDQVQ-EQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEE----DLERSEERLK 107
Query  541  SDIRELEAALDNANRANSEYLKQI---KSL--QQRVKELETLLEEERRVSDDLRNQLGVA 595
                +LE A  +A+   SE ++++   +S+  ++R++ LE  L+E R +++D       A
Sbjct  108  IATAKLEEASQSADE--SERMRKMLEHRSITDEERMEGLENQLKEARMMAED-------A 158
Query  596  ERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEI-----TLQVTSLTNDKRR 650
            +RK   +A++L    A LE AE   +  E+++ +    L  +     +L+V+     +R 
Sbjct  159  DRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQRE 218
Query  651  L--EADLSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLE 708
               E  +  M + L +A      AE   ++L  E GRL DEL +E+E YK   S+  +L+
Sbjct  219  EAHEQQIRIMTTKLKEAEARAEFAERSVQKLQKEVGRLEDELVHEKEKYK---SISDELD 275
Query  709  VEIREIT 715
                E+T
Sbjct  276  QTFAELT 282

Sequence Alignment: 15. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 55.2 bits 214,  Expect = 1e-08
 Identities = 70/259 27%, Positives = 123/259 47%, Gaps = 21/259 8%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K       D R L  + +A RD+   A K  EEA R  + K+ + +  L+
Sbjct  2    DAIKKKMQAMKLEKDNALD-RALLCEQQA-RDANLRAEKAEEEA-RQLQKKIQAIENDLD 58
Query  487  QLK---IDMENRLREKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFE 540
            Q +   + +  +L EK++ ++N     A   R I+ L+  L   E R  +  +++     
Sbjct  59   QTQEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLS---- 114
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
                E  AA D + RA      +  + ++R+  LE  L+E R ++++   +     RK  
Sbjct  115  ----EASAAADESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLA 170
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE--ADLSAM 658
             +  +LE A    E  E      E EL      L   +L+V+    ++R  E    +  +
Sbjct  171  MVEADLERAEERAEAGEGKIVELEEELRVVGNNLK--SLEVSEEKANQREEEYKNQIKTL 228
Query  659  QSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYK 698
             + L +A      AE   ++L  E  RL DEL  E+E Y+
Sbjct  229  TTRLKEAEARAEFAERSVQKLQKEVDRLEDELVMEKEKYR 268

Sequence Alignment: 16. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 54.9 bits 213,  Expect = 1e-08
 Identities = 73/268 27%, Positives = 130/268 48%, Gaps = 34/268 12%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K       D      Q   E +  A   + TEE +R    K+   +  L+
Sbjct  2    DAIKKKMQAMKLEKDNAMDRADTLEQQNKEANIRA---EKTEEEIRITHKKMQQVENELD 58
Query  487  QLK--IDMEN-RLREKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFE 540
            Q++  + + N +L EK++ ++N     A   R I+ L+  L   E R  T  +++     
Sbjct  59   QVQEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLA---- 114
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
                E   A D + R       +  S ++R+  LE  L+E R ++++       A+RK  
Sbjct  115  ----EASQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEE-------ADRKYD 163
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQS 660
             +A++L    A LE AE   +  E+++ +    L  +   + SL   + +      A + 
Sbjct  164  EVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKE 223
Query  661  DLDDAINNQRGAEERAE-------RLAAENGRLADELRQEQENYKNAESLRKQLEVEIRE 713
             +    N  + AE RAE       +L  E  RL DEL  E+E YK   S+  +L+    E
Sbjct  224  QIKTLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK---SITDELDQTFSE 280
Query  714  IT 715
            ++
Sbjct  281  LS 282

Sequence Alignment: 17. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 54.9 bits 213,  Expect = 1e-08
 Identities = 84/256 32%, Positives = 144/256 56%, Gaps = 45/256 17%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            ME +K++MQ    +LE        K++++++A+     + ++  ++ E ++  V+ L K+
Sbjct  1    MEAIKKKMQA--MKLE--------KDNAIDRAEIA-EQKSRDANLKAEKSEEEVRGLQKK 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRN-EKALL--EQDVQKLRVSNAELTERNDNLQREN 422
             +Q+ENE   L +  E +T  N  L   EKAL   E DV  L   N  +    ++L+R  
Sbjct  50   IQQIENE---LDQVQESFTQANTKLEEKEKALQTAEGDVAAL---NRRIQLIEEDLERSE 103
Query  423  KHL---SDQLREANLALKDANRELADLRQLRSQLEAER-DSLAAALKDTEEALRDAEAKL 478
            + L   + +L EA+ A  D +  +  + + RS  + ER D L   LK+      DA+ K 
Sbjct  104  ERLKVATAKLEEASHA-ADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKY 162
Query  479  ASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT-EISRMKK 537
                  L  ++ D+E R  E+ E  E+        I EL+  L  V    K+ E+S  K 
Sbjct  163  DEVARKLAMVEADLE-RAEERAETGES-------KIVELEEELRVVGNNLKSLEVSEEKA 214
Query  538  K-----FESDIRELEAALDNANRANSEYL-KQIKSLQQRVKELETLL----EEERRVSDD 587
            +     +E  IR + A L  A  A +E+  + ++ LQ+ V  LE  L    E+ + +SD+
Sbjct  215  QQREEAYEQQIRIMTAKLKEAE-ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDE 273
Query  588  L 588
            L
Sbjct  274  L 274

Sequence Alignment: 18. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 54.5 bits 211,  Expect = 2e-08
 Identities = 92/249 36%, Positives = 142/249 57%, Gaps = 41/249 16%
Query  485  LNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
            ++ +K  M+    EKD  ++      A A EE  R + +   R + E+   +KK      
Sbjct  1    MDAIKKKMQAMKIEKDNALDR-----ADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEN 55
Query  545  ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQ 604
            +L+ A ++ + ANS   ++ K +Q+   E+  L    RR++  L  +L  AE +R+ LA 
Sbjct  56   DLDKAQEDLSVANSNLEEKEKKVQEAEAEVAAL---NRRMTL-LEEELERAE-ERLKLAT 110
Query  605  E-LEDARALLEGAERARKNAET------ELADT-STRLSEITLQVTSLTNDKRRLEA--D 654
            E LE+A    + +ER RK  E       E A+T  ++L E   Q+ +   D++  E    
Sbjct  111  EKLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEA--QMLAEEADRKYDEVARK 168
Query  655  LSAMQSDLDDAINNQRGAEERAERLAAENG--RLADELRQEQENYKNAE-SLRKQLEVE- 710
            L+ +++DL+ A       EERAE  A EN    L +ELR    N K+ E S  K L+ E 
Sbjct  169  LAMVEADLERA-------EERAE--AGENKIVELEEELRVVGNNLKSLEVSEEKALQRED 219
Query  711  -----IREITIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVR 755
                 IR ++ RL+EAE  A +   R V KLQ  V  LE EL +E  R +
Sbjct  220  SYEEQIRTVSARLKEAETRA-EFAERSVQKLQKEVDRLEDELVHEKERYK 268

Sequence Alignment: 19. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 72/259 27%, Positives = 120/259 46%, Gaps = 21/259 8%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K       D R L  + +A RD+   A K  EEA R  + K+   +  L+
Sbjct  2    DAIKKKMQAMKLEKDNAMD-RALLCEQQA-RDANLRAEKAEEEA-RSLQKKIQQIENDLD 58
Query  487  QLK---IDMENRLREKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFE 540
            Q     + +  +L EKD+ ++N     A   R I+ L+  L   E R  T  +++     
Sbjct  59   QTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLA---- 114
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
                E   A D + RA      +  + ++R+  LE  L+E R ++++   +     RK  
Sbjct  115  ----EASQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLA 170
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE--ADLSAM 658
             +  +LE A    E  E      E EL      L   +L+V+    + R  E    +  +
Sbjct  171  MVEADLERAEERAESGESKIVELEEELRVVGNNLK--SLEVSEEKANLREEEYKQQIKTL 228
Query  659  QSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYK 698
             + L +A      AE   ++L  E  RL DEL +E+E YK
Sbjct  229  TTRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 20. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 71/266 26%, Positives = 131/266 49%, Gaps = 18/266 6%
Query  485  LNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
            +  +K  M+    EKD  I+      A   E+  R       + + E+  ++KK +    
Sbjct  1    MEAIKKKMQAMKLEKDNAID-----RAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIEN 55
Query  545  ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQ 604
            EL+   ++  +AN++  ++ KSLQ    ++  L    + + +DL       ER +VA A+
Sbjct  56   ELDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERS---EERLKVATAK 112
Query  605  ELEDARALLEGAERARKNAETELADTSTRLSEITLQVTS---LTNDKRR----LEADLSA 657
             LE+A    + +ER RK  E        R+  +  Q+     +  D  R    +   L+ 
Sbjct  113  -LEEASHSADESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAM 171
Query  658  MQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIR 717
            +++DL+ A       E +   L  E   + + L+  + + + A+   +  E +IR +T +
Sbjct  172  VEADLERAEERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGK 231
Query  718  LEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVRESVANQ 761
            L+EAEA A +   R V KLQ  V  LE EL +E  + + S++++
Sbjct  232  LKEAEARA-EFAERSVRKLQKEVDRLEDELVHEKEKYK-SISDE 273

Sequence Alignment: 21. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 72/259 27%, Positives = 120/259 46%, Gaps = 21/259 8%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K       D R L  + +A RD+   A K  EEA R  + K+   +  L+
Sbjct  2    DAIKKKMQAMKLEKDNAMD-RALLCEQQA-RDANIRAEKAEEEA-RSLQKKIQQIENDLD 58
Query  487  QLK---IDMENRLREKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFE 540
            Q     + +  +L EKD+ ++N     A   R I+ L+  L   E R  T  +++     
Sbjct  59   QTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLA---- 114
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
                E   A D + RA      +  + ++R+  LE  L+E R ++++   +     RK  
Sbjct  115  ----EASQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLA 170
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE--ADLSAM 658
             +  +LE A    E  E      E EL      L   +L+V+    + R  E    +  +
Sbjct  171  MVEADLERAEERAETGESKIVELEEELRVVGNNLK--SLEVSEEKANLREEEYKQQIKTL 228
Query  659  QSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYK 698
             + L +A      AE   ++L  E  RL DEL +E+E YK
Sbjct  229  NTRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 22. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 88/251 35%, Positives = 140/251 55%, Gaps = 37/251 14%
Query  485  LNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
            ++ +K  M+    EKD  ++      A A EE  R + +   R + E+   +KK      
Sbjct  1    MDAIKKKMQAMKIEKDNALDR-----ADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEN 55
Query  545  ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAE-RKRVALA 603
            +L+ A ++ + ANS   ++ K +Q+   E+  L    RR++  L  +L  AE R ++A A
Sbjct  56   DLDKAQEDLSTANSNLEEKEKKVQEAEAEVAAL---NRRMTL-LEEELERAEERLKLATA 111
Query  604  QELEDARALLEGAERARKNAET------ELADT-STRLSEITLQVTSLTNDKRRLEA--D 654
            + LE+A    + +ER RK  E       E A+T  ++L E   Q+ +   D++  E    
Sbjct  112  K-LEEATHTADESERVRKVMENRSFQDEERANTVESQLKEA--QMLAEEADRKYDEVARK 168
Query  655  LSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAE-SLRKQLEVE--- 710
            L+ +++DL+ A       EERAE    +   L +ELR    N K+ E S  K L+ E   
Sbjct  169  LTMVEADLERA-------EERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSY 221
Query  711  ---IREITIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVR 755
               IR ++ RL+EAE  A +   R V KLQ  V  LE EL +E  R +
Sbjct  222  EEQIRTVSARLKEAETRA-EFAERSVQKLQKEVDRLEDELVHEKERYK 268

Sequence Alignment: 23. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 69/245 28%, Positives = 132/245 53%, Gaps = 26/245 10%
Query  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
            D  K+  Q   LE +NA  +  + E   ++  LR EKA  E++ ++L+     +    D 
Sbjct  2    DAIKKKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKA--EEEARQLQKKIQTIENELDQ 59
Query  418  LQRENKHLSDQLREANLALKDANRELADLRQ----LRSQLEAERDSLAAALKDTEEALRD 473
             Q    +++ +L E   AL++A  E+A L +    L   LE   + LA A     EA + 
Sbjct  60   TQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQA 119
Query  474  AEA-----KLASAQAALNQLKID-MENRLREK-------DEEIENVRRSSARAIEELQRT 520
            A+      K+   ++  ++ ++D +EN+L+E        D++ + V R  A    +L+R 
Sbjct  120  ADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERA 179
Query  521  LVEVETRYKTEISRMKKKFE---SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETL 577
                E+  +++I  +++++    ++++ LE + + AN+   EY  QIK+L  R+KE E  
Sbjct  180  EERAESG-ESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEAR 238
Query  578  LEEERRVSDDLRNQLGVAERKRVALAQELED 608
             E   R    L+ ++   E + VA  ++ +D
Sbjct  239  AEFAERSVQKLQKEVDRLEDELVAEKEKYKD 269

Sequence Alignment: 24. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 53.8 bits 208,  Expect = 3e-08
 Identities = 71/259 27%, Positives = 118/259 45%, Gaps = 21/259 8%
Query  427  DQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALN 486
            D +++   A+K       D   L  Q    RD+   A K  EEA R  + K+   +  L+
Sbjct  2    DAIKKKMQAMKLEKDNAMDCALLCEQ--QARDANLRAEKAEEEA-RSLQKKIQQIENDLD 58
Query  487  QLK---IDMENRLREKDEEIENVRRSSA---RAIEELQRTLVEVETRYKTEISRMKKKFE 540
            Q     + +  +L EKD+ ++N     A   R I+ L+  L   E R  T  +++     
Sbjct  59   QTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLA---- 114
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV 600
                E   A+D + RA      +  + ++R+  LE  L+E R ++++   +     RK  
Sbjct  115  ----EASQAVDESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLA 170
Query  601  ALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE--ADLSAM 658
             +  +LE A    E  E      E EL      L   +L+V+    + R  E    +  +
Sbjct  171  MVEADLERAEERAESGESKIVELEEELRVVGNNLK--SLEVSEEKANLREEEYKQQIKTL 228
Query  659  QSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYK 698
             + L +A      AE   ++L  E  RL DEL +E+E YK
Sbjct  229  TTRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 25. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 53.3 bits 206,  Expect = 4e-08
 Identities = 82/265 30%, Positives = 155/265 58%, Gaps = 68/265 25%
Query  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANREL----ADLRQLRSQ 452
            +++ +Q +++      +R D L+++NK       EANL  +    E+      ++Q+ ++
Sbjct  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANLRAEKTEEEIRATQKKMQQVENE 56
Query  453  LEAERDSLAAA---LKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRS 509
            L+  ++ L+AA   L + E+AL++AE ++A    ALN+       R++  +E++E   RS
Sbjct  57   LDQAQEQLSAANTKLDEKEKALQNAEGEVA----ALNR-------RIQLLEEDLE---RS 102
Query  510  SARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQ 569
              R +      L E  ++   E  RM+K +E             NR+ S+        ++
Sbjct  103  EER-LNTATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EE 139
Query  570  RVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELAD 629
            R+  LE  L+E R ++++       A+RK   +A++L    A LE AE   ++ E+++ +
Sbjct  140  RMDALENQLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAESGESKIVE 192
Query  630  TSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAE 682
                L  +   + SL   + +        +  +    N  + AE RAE       +L  E
Sbjct  193  LEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQKE 252
Query  683  NGRLADELRQEQENYKNAESLRKQLEVEIREIT 715
              RL DEL  E+E YK   S+  +L+    E++
Sbjct  253  VDRLEDELVNEKEKYK---SITDELDQTFSELS 282

Sequence Alignment: 26. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 53.3 bits 206,  Expect = 4e-08
 Identities = 83/257 32%, Positives = 145/257 56%, Gaps = 45/257 17%
Query  305  EMEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTK 364
            +ME +K++MQ    +LE        K++++++A+     + ++  +  E ++  V+ L K
Sbjct  15   KMEAIKKKMQA--MKLE--------KDNAIDRAEIA-EQKARDANLRAEKSEEEVRALQK 63
Query  365  RNRQLENENAGLQRRIEELTGENNTLRN-EKALL--EQDVQKLRVSNAELTERNDNLQRE 421
            + +Q+ENE   L +  E+L+  N  L   EKAL   E DV  L   N  +    ++L+R 
Sbjct  64   KIQQIENE---LDQVQEQLSAANTKLEEKEKALQTAEGDVAAL---NRRIQLIEEDLERS 117
Query  422  NKHL---SDQLREANLALKDANRELADLRQLRSQLEAER-DSLAAALKDTEEALRDAEAK 477
             + L   + +L EA+ +  D +  +  + + RS  + ER D L   LK+      DA+ K
Sbjct  118  EERLKIATAKLEEASQS-ADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRK 176
Query  478  LASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT-EISRMK 536
                   L  ++ D+E R  E+ E  E+        I EL+  L  V    K+ E+S  K
Sbjct  177  YDEVARKLAMVEADLE-RAEERAETGES-------KIVELEEELRVVGNNLKSLEVSEEK 228
Query  537  KK-----FESDIRELEAALDNANRANSEYL-KQIKSLQQRVKELETLL----EEERRVSD 586
             +     +E  IR + A L  A  A +E+  + ++ LQ+ V  LE  L    E+ + +SD
Sbjct  229  AQQREEAYEQQIRIMTAKLKEAE-ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISD 287
Query  587  DL 588
            +L
Sbjct  288  EL 289

Sequence Alignment: 27. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 52.8 bits 203,  Expect = 4e-08
 Identities = 66/195 33%, Positives = 106/195 54%, Gaps = 26/195 13%
Query  544  RELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALA 603
            +E +  ++ A +  SE  ++I+SL +R++    LLEE+   S+         ER + A  
Sbjct  14   QECQTKMEEAEKTASEAEQEIQSLNRRIQ----LLEEDMERSE---------ERLQTA-T 59
Query  604  QELEDARALLEGAERARK------NAETELADTSTR-LSEITLQVTSLTNDKRRLEA--D 654
            ++LE+A    + +ER RK      NA  E  D   + L+E  L   +   DK+  EA   
Sbjct  60   EKLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKL--IAEEADKKYDEAARK 117
Query  655  LSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREI 714
            L+  + DL+ A      AE +   L  E   + + ++  + + + A       E  IR++
Sbjct  118  LAITEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDL 177
Query  715  TIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVR 755
            T RL++AE  AT E  R V+KLQ  V  LE EL  E  R +
Sbjct  178  TQRLKDAENRAT-EAERTVSKLQKEVDRLEDELLAEKERYK 217

Sequence Alignment: 28. Allergen Name: Hom s 5 Sequence ID: P02538

 Score = 54.0 bits 210,  Expect = 4e-08
 Identities = 83/333 24%, Positives = 155/333 46%, Gaps = 21/333 6%
Query  190  LSELTSLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNL 249
            + E+T  +S LT  N+ +   +Q + +      K  +   AS  D  R L+   +Q + L
Sbjct  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLE---QQNKVL 191
Query  250  QVNLSALQADYDNLNVR--LEEEAETS-TNLRNQLSKVNADYSALKSRFDKELALKMEEM 306
            +   + LQ +     VR  LE   E    NLR QL  +  +    + R+D EL    + +
Sbjct  192  ETKWTLLQ-EQGTKTVRQNLEPLFEQYINNLRRQLDSIVGE----RGRLDSELRGMQDLV 246
Query  307  EDLKRRMQVRI---TELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQ-DL 362
            ED+K + +  I   T  E+    L+    +    K +L  +   +T E+   + +   +L
Sbjct  247  EDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRALYDAEL 306
Query  363  TKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRV-SNAELTERNDNLQRE 421
            ++   ++ + +  L          ++ +   KA  E+  Q+ R  + +    + + LQ  
Sbjct  307  SQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVT 366
Query  422  NKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEE----ALRDAEAK 477
                 D LR     + + NR +  LR    +++ +  +L AA+ D E+    AL+DA+ K
Sbjct  367  AGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNK 426
Query  478  LASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTE 531
            L   + AL + K D+  RL ++ +E+ NV+ +    I   ++ L   E R   E
Sbjct  427  LEGLEDALQKAKQDLA-RLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGE 479

Sequence Alignment: 29. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 52.9 bits 204,  Expect = 5e-08
 Identities = 75/267 28%, Positives = 132/267 49%, Gaps = 26/267 9%
Query  368  QLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSD 427
            +LE +NA    R + L  +N    N     E++V+ L+    +L    D +Q      ++
Sbjct  2    KLEKDNA--MDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANN 59
Query  428  QLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQ 487
            QL E + AL +A  E+A L + R QL  E D     L+ +EE L  A  KLA A  A ++
Sbjct  60   QLVEKDKALSNAEGEVAALNR-RIQL-LEED-----LERSEERLNTATTKLAEASQAADE 112
Query  488  ---LKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIR 544
               ++  +ENR    +E ++ +      A     R L E   R   E++R     E+D+ 
Sbjct  113  SERMRKVLENRSLSDEERMDALENQLKEA-----RFLAEEADRKYDEVARKLAMVEADLE 167
Query  545  ELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRV-ALA 603
              E   +       E  ++++ +   +K LE        VS++  NQ   A ++++  L 
Sbjct  168  RAEERAETGESKIVELEEELRVVGNNLKSLE--------VSEEKANQREEAYKEQIKTLT 219
Query  604  QELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLS 656
             +L+ A A  E AER+ +  + E+      L     +  S+T++  +  ++LS
Sbjct  220  NKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS 272

Sequence Alignment: 30. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 52.6 bits 203,  Expect = 6e-08
 Identities = 78/274 28%, Positives = 146/274 53%, Gaps = 49/274 17%
Query  400  DVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDS 459
            D  K ++   +L E+++ + R +  L  Q +EAN+  + A  E+ +L++   +LE + D 
Sbjct  2    DAIKKKMQATKL-EKDNAMDRADT-LEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQ 59
Query  460  LAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQR 519
            +  +L      L + +  +++A+  +  L      R++  +E++E   RS  R +     
Sbjct  60   VQESLLKANTQLEEKDKAISNAEGEVAAL----NRRIQLLEEDLE---RSEER-LNTATT 111
Query  520  TLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE 579
             L E  ++   E  RM+K +E             NR+ S+        ++R+  LE  L+
Sbjct  112  KLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALENQLK 149
Query  580  EERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEITL 639
            E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  +  
Sbjct  150  EARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGN 202
Query  640  QVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADELRQ 692
             + SL   + +      A +  +    N  + AE RAE       +L  E  RL DEL  
Sbjct  203  NLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVN 262
Query  693  EQENYKNAESLRKQLEVEIREIT 715
            E+E YK   S+  +L+    E+T
Sbjct  263  EKEKYK---SITDELDQTFSELT 282

Sequence Alignment: 31. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 77/272 28%, Positives = 147/272 54%, Gaps = 54/272 19%
Query  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAE 456
            +++ +Q +++      +R D L+++NK       EAN+  + +  E+ +L++   QLE +
Sbjct  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANIRAEKSEEEVHNLQKRMQQLEND 56
Query  457  RDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEE 516
             D +  +L      L + +  L++A+  +  L      R++  +E++E   RS  R +  
Sbjct  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNT 108
Query  517  LQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET 576
                L E  ++   E  RM+K +E             NR+ S+        ++R+  LE 
Sbjct  109  ATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALEN 146
Query  577  LLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSE 636
             L+E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  
Sbjct  147  QLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRV 199
Query  637  ITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADE 689
            +   + SL   + +      A +  +    N  + AE RAE       +L  E  RL DE
Sbjct  200  VGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDRLEDE 259
Query  690  LRQEQENYKNAESLRKQLEVEIREIT 715
            L  E+E YK   S+  +L+    E++
Sbjct  260  LVNEKEKYK---SITDELDQTFSELS 282

Sequence Alignment: 32. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 79/272 29%, Positives = 147/272 54%, Gaps = 54/272 19%
Query  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAE 456
            +++ +Q +++      +R D L+++NK       EAN   + +  E+  L++   QLE +
Sbjct  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANNRAEKSEEEVFGLQKKLQQLEND 56
Query  457  RDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEE 516
             DS+  AL    + L + +  L++A+  +  L      R++  +E++E   RS  R +  
Sbjct  57   LDSVQEALLKANQHLEEKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNT 108
Query  517  LQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET 576
                L E  ++   E  RM+K +E             NR+ S+        ++R+  LE 
Sbjct  109  ATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALEN 146
Query  577  LLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSE 636
             L+E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  
Sbjct  147  QLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRV 199
Query  637  ITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADE 689
            +   + SL   + +      A +  +    N  + AE RAE       +L  E  RL DE
Sbjct  200  VGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDE 259
Query  690  LRQEQENYKNAESLRKQLEVEIREIT 715
            L  E+E YK   S+  +L+    E++
Sbjct  260  LVNEKEKYK---SITDELDQTFSELS 282

Sequence Alignment: 33. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 52.2 bits 201,  Expect = 8e-08
 Identities = 79/272 29%, Positives = 148/272 54%, Gaps = 54/272 19%
Query  397  LEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAE 456
            +++ +Q +++      +R D L+++NK       EAN   + +  E+ +L++   QLE +
Sbjct  4    IKKKMQAMKLEKDNAMDRADTLEQQNK-------EANNRAEKSEEEVHNLQKRMQQLEND 56
Query  457  RDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEE 516
             DS+  AL    + L + +  L++A+  +  L      R++  +E++E   RS  R +  
Sbjct  57   LDSVQEALLKANQHLEEKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNT 108
Query  517  LQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELET 576
                L E  ++   E  RM+K +E             NR+ S+        ++R+  LE 
Sbjct  109  ATTKLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALEN 146
Query  577  LLEEERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSE 636
             L+E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  
Sbjct  147  QLKEARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRV 199
Query  637  ITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADE 689
            +   + SL   + +      A +  +    N  + AE RAE       +L  E  RL DE
Sbjct  200  VGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDE 259
Query  690  LRQEQENYKNAESLRKQLEVEIREIT 715
            L  E+E YK   S+  +L+    E++
Sbjct  260  LVNEKEKYK---SITDELDQTFSELS 282

Sequence Alignment: 34. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 52.0 bits 200,  Expect = 9e-08
 Identities = 85/271 31%, Positives = 147/271 54%, Gaps = 51/271 18%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            M+ +K++MQ    +LE        K++++++A T L  + KE     E ++  V++L KR
Sbjct  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKR 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
             +QLEN+   +Q  +         L+    L+E+D     +SNAE       L R  + L
Sbjct  50   MQQLENDLDQVQESL---------LKANIQLVEKDKA---LSNAE--GEVAALNRRIQLL 95
Query  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
Query  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
Query  594  VAERKRVALAQELEDARALLEG 615
              + K  ++  EL+   + L G
Sbjct  262  NEKEKYKSITDELDQTFSELSG 283

Sequence Alignment: 35. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 52.0 bits 200,  Expect = 9e-08
 Identities = 77/261 29%, Positives = 139/261 53%, Gaps = 46/261 17%
Query  400  DVQKLRVSNAELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDS 459
            D  K ++   +L E++D + R +  L  Q +EAN+  + A  E+ +L++   QLE + D 
Sbjct  2    DAIKKKMQAMKL-EKDDAMDRADT-LEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQ 59
Query  460  LAAALKDTEEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQR 519
            +  +L      L + +  L++A+  +  L      R++  +E++E   RS  R +     
Sbjct  60   VQESLLKANTQLEEKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNTATT 111
Query  520  TLVEVETRYKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE 579
             L E  ++   E  RM+K +E             NR+ S+        ++R+  LE  L+
Sbjct  112  KLAEA-SQAADESERMRKVLE-------------NRSLSD--------EERMDALENQLK 149
Query  580  EERRVSDDLRNQLGVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEITL 639
            E R ++++       A+RK   +A++L    A LE AE   +  E+++ +    L  +  
Sbjct  150  EARFLAEE-------ADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGN 202
Query  640  QVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADELRQ 692
             + SL   + +      A +  +    N  + AE RAE       +L  E  RL DEL  
Sbjct  203  NLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELVN 262
Query  693  EQENYKN 699
            E+E YK+
Sbjct  263  EKEKYKS 269

Sequence Alignment: 36. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 52.0 bits 200,  Expect = 9e-08
 Identities = 85/271 31%, Positives = 147/271 54%, Gaps = 51/271 18%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            M+ +K++MQ    +LE        K++++++A T L  + KE     E ++  V++L KR
Sbjct  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKR 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
             +QLEN+   +Q  +         L+    L+E+D     +SNAE       L R  + L
Sbjct  50   MQQLENDLDQVQESL---------LKANIQLVEKDKA---LSNAE--GEVAALNRRIQLL 95
Query  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
Query  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
Query  594  VAERKRVALAQELEDARALLEG 615
              + K  ++  EL+   + L G
Sbjct  262  NEKEKYKSITDELDQTFSELSG 283

Sequence Alignment: 37. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 52.0 bits 200,  Expect = 9e-08
 Identities = 85/271 31%, Positives = 147/271 54%, Gaps = 51/271 18%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            M+ +K++MQ    +LE        K++++++A T L  + KE     E ++  V++L KR
Sbjct  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANNRAEKSEEEVHNLQKR 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
             +QLEN+   +Q  +         L+    L+E+D     +SNAE       L R  + L
Sbjct  50   MQQLENDLDQVQESL---------LKANIQLVEKDKA---LSNAE--GEVAALNRRIQLL 95
Query  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
Query  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
Query  594  VAERKRVALAQELEDARALLEG 615
              + K  ++  EL+   + L G
Sbjct  262  NEKEKYKSITDELDQTFSELSG 283

Sequence Alignment: 38. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 76/262 29%, Positives = 140/262 53%, Gaps = 48/262 18%
Query  413  ERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALR 472
            E+++ + R +  L  Q +EAN+  + A  E+ +L++   QLE + D +  +L      L 
Sbjct  4    EKDNAMDRADT-LEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQLE 62
Query  473  DAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEI 532
            + +  L++A+  +  L      R++  +E++E   RS  R +      L E  ++   E 
Sbjct  63   EKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNTATTKLAEA-SQAADES 113
Query  533  SRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQL 592
             RM+K +E             NR+ S+        ++R+  LE  L+E R ++++     
Sbjct  114  ERMRKVLE-------------NRSLSD--------EERMDALENQLKEARFLAEE----- 147
Query  593  GVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE 652
              A+RK   +A++L    A LE AE   +  E+++ +    L  +   + SL   + +  
Sbjct  148  --ADRKYDEVARKLAMVEADLERAEERAETGESKFVELEEELRVVGNNLKSLEVSEEKAN 205
Query  653  ADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADELRQEQENYKNAESLRK 705
                A +  +    N  + AE RAE       +L  E  RL DEL  E+E YK   S+  
Sbjct  206  QREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK---SITD 262
Query  706  QLEVEIREIT 715
            +L+    E++
Sbjct  263  ELDQTFSELS 272

Sequence Alignment: 39. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 51.1 bits 196,  Expect = 2e-07
 Identities = 80/243 32%, Positives = 131/243 53%, Gaps = 39/243 16%
Query  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
            D  K+  Q   L+ ENA    R E   G+     ++   LE D+  L+    +L    D 
Sbjct  2    DAIKKKMQMLKLDKENA--LDRAEGAEGDKKAAEDKSKQLEDDLVALQ---KKLKGTEDE 56
Query  418  LQRENKHLSDQLREANLALKDANRELADLRQL--RSQL-EAERDS----LAAALKDTEEA 470
            L + ++ L D   +  +A K A    AD+  L  R QL E E D     LA AL   EEA
Sbjct  57   LDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEA 116
Query  471  LRDAEAKLASAQAALNQLKIDMENRLREKD---EEIENVRRSSARAIEELQRTLVEVE-- 525
             + A+      +   N+   D E ++  +D   +E +++   + R  EE+ R LV +E  
Sbjct  117  EKAADESERGMKVIENRASKD-EEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESD 175
Query  526  ---TRYKTEISRMK--------KKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKEL 574
               T  + E+S  K        K   ++++ LEA  +  ++   +Y ++IK L  ++KE 
Sbjct  176  LERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEA 235
Query  575  ETLLE-EERRVS------DDLRNQLGVAERKRVALAQELEDA 609
            ET  E  ER V+      DDL ++L   + K  A+++EL++A
Sbjct  236  ETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNA 277

Sequence Alignment: 40. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 50.4 bits 193,  Expect = 3e-07
 Identities = 82/256 32%, Positives = 144/256 56%, Gaps = 45/256 17%
Query  306  MEDLKRRMQVRITELEDT------CE-QLRVKNSSLEKAKTK---LANEIKEITIELENT 355
            M+ +K++MQ    E ++       CE Q R  N   EKA+ +   L  +I+ I  +L+ T
Sbjct  1    MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT 60
Query  356  Q----IIVQDLTKRNRQLEN---ENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSN 408
            Q    ++   L  + + L+N   E A L RRI+ L GE+   R+E+ L     +    S 
Sbjct  61   QGQETLVNGKLEGKEKALQNAESEVAALNRRIQ-LLGEDLD-RSEERLASATAKLSEASA 118
Query  409  A-ELTERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDT 467
            A + +ER   +  EN+ L+D+ R    AL++   +L + R L  + + + D +A  L   
Sbjct  119  AADESERARKIL-ENRSLADEERMD--ALEN---QLKEARFLAEEADKKYDEVARKLAMV 172
Query  468  EEALRDAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETR 527
            E  L  AE +  + +A +    +++E  LR     ++++  S  +A    QR     E  
Sbjct  173  EADLERAEERAEAGEAKI----VELEEELRVVGNNLKSLEVSEEKAN---QR-----EEE 220
Query  528  YKTEISRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDD 587
            YK +I    K + + ++E EA  + A R+  +  K++  L+    EL +  E+ R + DD
Sbjct  221  YKNQI----KTLTTRLKEAEARAEFAERSVQKLQKEVDRLED---ELVSEKEKYREIGDD 273
Query  588  L 588
            L
Sbjct  274  L 274

Sequence Alignment: 41. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 49.0 bits 187,  Expect = 7e-07
 Identities = 86/271 31%, Positives = 144/271 53%, Gaps = 51/271 18%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            M+ +K++MQ    +LE        K++++++A T L  + KE  I  E  +  V  L K+
Sbjct  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANIRAEKAEDDVNKLQKK 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
             +QLEN+   +Q  +  L    N +  +KAL          SNAE       L R  + L
Sbjct  50   LQQLENDFDQVQEAL--LLANTNAVEKDKAL----------SNAE--GEVAALNRRIQLL 95
Query  426  SDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAAL 485
             + L  +   L  A  +LA+  Q   + E  R  L         +L D E       A  
Sbjct  96   EEDLERSEERLNTATTKLAEASQAADESERMRKVLE------NRSLSDEE----RMDALE 145
Query  486  NQLKIDMENRL--REKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFE--- 540
            NQLK   E R+   E D + + V R  A    +L+R     ET  +++I  +++++    
Sbjct  146  NQLK---EARFLAEEADRKYDEVARKLAMVEADLERAEERAETG-ESKIVELEEELRVVG 201
Query  541  SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE-EERRVS------DDLRNQLG 593
            ++++ LE + + AN+    Y +QIK+L  ++K  E   E  ER V       D L ++L 
Sbjct  202  NNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELV 261
Query  594  VAERKRVALAQELEDARALLEG 615
              + K  ++  EL+   + L G
Sbjct  262  NEKEKYKSITDELDQTFSELSG 283

Sequence Alignment: 42. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 49.0 bits 187,  Expect = 7e-07
 Identities = 80/244 32%, Positives = 131/244 53%, Gaps = 37/244 15%
Query  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
            D  K+  Q   L+ ENA    R E+   +     +    LE D+  L+    +L    D 
Sbjct  2    DAIKKKMQMLKLDKENA--LDRAEQAESDKKAAEDRSKQLEDDLVALQ---KKLKGTEDE 56
Query  418  LQRENKHLSDQLREANLALKDANRELADLRQL--RSQL-EAERDS----LAAALKDTEEA 470
            L + ++ L D   +  L+ K A    AD+  L  R QL E E D     LA AL+  EEA
Sbjct  57   LDKYSEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Query  471  LRDAEAKLASAQAALNQ-LKIDMENRLRE-KDEEIENVRRSSARAIEELQRTLVEVE--- 525
             + A+      +   N+ LK + +  ++E + +E +++   + R  EE+ R LV VE   
Sbjct  117  EKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGEL 176
Query  526  --TRYKTEISRMK--------KKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELE 575
              T  + E+S  K        K   + ++ LEA  +  ++   +Y ++IK L  ++KE E
Sbjct  177  ERTEERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAE 236
Query  576  TLLE-EERRVS------DDLRNQLGVAERKRVALAQELEDA 609
            T  E  ER V+      DDL ++L   + K  A+++EL+ A
Sbjct  237  TRAEFAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHA 277

Sequence Alignment: 43. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 48.4 bits 184,  Expect = 1e-06
 Identities = 64/221 28%, Positives = 121/221 54%, Gaps = 27/221 12%
Query  361  DLTKRNRQ---LENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDN 417
            D  K+  Q   LE +N   +  + E    +  LR EKA  E++ + L+    ++    D 
Sbjct  2    DAIKKKMQAMKLEKDNTMDRALLCEQQARDANLRAEKA--EEEARSLQKKIQQIENDLDQ 59
Query  418  LQRENKHLSDQLREANLALKDANRELADLRQ----LRSQLEAERDSLAAALKDTEEALRD 473
               +  +++ +L E + AL++A  E+A L +    L   LE   + LA A     EA + 
Sbjct  60   TMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQA 119
Query  474  AEA-----KLASAQAALNQLKID-MENRLREK-------DEEIENVRRSSARAIEELQRT 520
            A+      K+  ++   ++ ++D +EN+L+E        D++ + V R  A    +L+R 
Sbjct  120  ADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERA 179
Query  521  LVEVETRYKTEISRMKKKFE---SDIRELEAALDNANRANSEYLKQIKSLQQRVKELETL 577
                E+  +++I  +++++    ++++ LE + + AN    EY +QIK+L  R+KE E  
Sbjct  180  EERAESG-ESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEAR 238
Query  578  LE-EERRV 584
             E  ER V
Sbjct  239  AEFAERSV 246

Sequence Alignment: 44. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 46.1 bits 174,  Expect = 5e-06
 Identities = 74/254 29%, Positives = 134/254 52%, Gaps = 33/254 12%
Query  306  MEDLKRRMQVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKR 365
            M+ +K++MQ    +LE        K++++++A T L  + KE  +  E T+  ++   K+
Sbjct  1    MDAIKKKMQA--MKLE--------KDNAMDRADT-LEQQNKEANLRAEKTEEEIRATQKK 49
Query  366  NRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHL 425
             +Q+ENE   L +  E+L+  N  L  ++  L+    ++   N  +    ++L+R  + L
Sbjct  50   MQQVENE---LDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERL 106
Query  426  ---SDQLREANLALKDANRELADLRQLRSQLEAER-DSLAAALKDTEEALRDAEAKLASA 481
               + +L EA+ A  D +  +  + + RS  + ER D+L   LK+      +A+ K    
Sbjct  107  NTATTKLAEASQA-ADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEV 165
Query  482  QAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKT-EISRMK-KKF 539
               L  ++ D+E R  E+ E       S    I EL+  L  V    K+ E+S  K  + 
Sbjct  166  ARKLAMVEADLE-RAEERAE-------SGESKIVELEEELRVVGNNLKSLEVSEEKANQR 217
Query  540  ESDIRELEAALDN---ANRANSEYL-KQIKSLQQRVKELETLLEEER 582
            E   +E    L N   A  A +E+  + ++ LQ+ V  LE  L  E+
Sbjct  218  EETYKEQIKTLANKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 45. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 44.9 bits 169,  Expect = 1e-05
 Identities = 70/231 30%, Positives = 132/231 57%, Gaps = 46/231 19%
Query  376  LQRRIEELTG--ENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREAN 433
            ++++++ L G  EN   R E+A L++ V + +    +L +    LQ++ K   D++ + +
Sbjct  4    IKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCK--QLEDELLGLQKKLKGTEDEVDKYS 61
Query  434  LALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQ------ 487
             ALKDA  +L    +  +  E E  +L   ++  EE L  A+ +L +A   L +      
Sbjct  62   EALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQAD 121
Query  488  -----LKIDMENRLREKDEEIE----------NVRRSSARAIEELQRTLVEVE-----TR 527
                 +K+ +ENR  + +E++E           +   S R  +E+ R LV +E       
Sbjct  122  ESERGMKV-IENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAE 180
Query  528  YKTEISRMK--------KKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLE 579
             + E+S +K        K   + ++ LEA  +  +    +Y ++I  L +++KE ET  E
Sbjct  181  ERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAE 240
Query  580  -EERRVS------DDLRNQLGVAERKRVALAQELEDA 609
              E+ VS      DDL ++L   + K  A+ +EL++A
Sbjct  241  FAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNA 277

Sequence Alignment: 46. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 41.7 bits 155,  Expect = 0.0001
 Identities = 79/260 30%, Positives = 139/260 53%, Gaps = 35/260 13%
Query  137  VEKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELT-- 194
            ++K+ Q + +E D       +  KA  T E++   A   A  +  +V +LT++L+++T  
Sbjct  4    IKKKMQAMKLEKDN------AADKAD-TCENQAKEANLRADKIMEEVAELTKRLTQVTED 56
Query  195  --SLKSRLTQENFDLQHQVQELDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVN 252
               +K+ L Q N DL+ + + L S  A +     ++Q   +DL++    E R    L   
Sbjct  57   HEKFKNTLEQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKS---EERSGAALSKL 113
Query  253  LSALQ-ADYDN-----LNVRLEEEAETSTNLRNQLSK---VNADYSALKSRFDKELALKM 303
            L A Q AD +N     L  R +++ E    L NQL +   +  D         ++LA+  
Sbjct  114  LEATQSADENNRMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVE 173
Query  304  EEMEDLKRRMQ---VRITELEDTCEQLRV-KNS--SLEKAKTKLANEIKEITIELENTQI 357
            +E+E  + R++    +I ELE   E+L+V  NS  SLE ++ K    ++E   +L++  I
Sbjct  174  DELEVAEDRVKSGEAKIMELE---EELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTI 230
Query  358  IVQDLTKRNRQLENENAGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELT 412
             +++   R    E     LQ+ ++ L    + L NEK   +     L  + AELT
Sbjct  231  KLKEAETRAENAEKNVKKLQKEVDRL---EDKLMNEKDKYKAICDDLDSTFAELT 282

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.