The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT
RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP
LGFYKKEALPKCAQVYNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA73037 Ole e 1.0106 146 1006 306.7 1.6e-85
CAA73038 Ole e 1.0105 146 991 302.2 3.6e-84
X76395 Ole e 1.0102 145 981 299.2 2.9e-83
P19963 Ole e 1 145 977 298.0 6.6e-83
CAA73036 Ole e 1.0107 146 962 293.5 1.5e-81
AAQ83588 Fra e 1.0201 146 940 287.0 1.4e-79
X76396 Ole e 1.0103 145 919 280.7 1.1e-77
CAA54819 Lig v 1.0102 145 906 276.8 1.7e-76
AAQ08947 Fra e 1.0101 145 904 276.2 2.5e-76
AAV74343 Fra e 1.0102 145 902 275.6 3.8e-76
X76397 Ole e 1.0104 145 900 275.0 5.8e-76
O82015 Lig v 1 145 900 275.0 5.8e-76
AAB32652 Ole e 1.0101 130 859 262.8 2.4e-72
A0A0K1SC24 Aca f 1 150 459 142.9 3.5e-36
AKV72167 Pro j 1.0101 150 423 132.1 6.2e-33
A0A0K1SC10 Ama r 1.0101 168 407 127.2 2.1e-31
ADK22842 Sal k 5.0101 151 381 119.5 3.8e-29
A0A0K1SC44 Koc s 1.0101 167 358 112.5 5.4e-27
AAL07319 Che a 1 168 355 111.6 1e-26
CAA33854 Lyc e LAT52 161 354 111.3 1.2e-26
CAC41635 Pla l 1.0103 131 290 92.4 4.9e-21
P82242 Pla l 1 131 283 90.3 2.1e-20
Q7M1X5 Lol p 11.0101 134 281 89.7 3.3e-20
AAN32987 Phl p 11.0101 143 271 86.6 2.9e-19
QFI57017 Scy p 9.0101 847 103 34.6 0.0075
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 306.7 bits 1006,  Expect = 2e-85
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
            RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
Query  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146
            LGFYKKEALPKCAQVYNKLGMYPPNM
Sbjct  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 2. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 302.2 bits 991,  Expect = 4e-84
 Identities = 144/146 98%, Positives = 145/146 99%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
            RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFIL+TVNGTTRTVNP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNP 120
Query  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146
            L FYKKEALPKCAQVYNKLGMYPPNM
Sbjct  121  LRFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 3. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 299.2 bits 981,  Expect = 3e-83
 Identities = 140/145 96%, Positives = 144/145 99%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGAS+RLQCKDKENGDVTFTE+GYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGW KPSLKFIL+TVNGTTRTVNPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKCAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 4. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 298.0 bits 977,  Expect = 7e-83
 Identities = 139/145 95%, Positives = 144/145 99%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            ED+PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGAS+RLQCKDKENGDVTFTE+GYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKF L+TVNGTTRTVNPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKCAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 5. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 293.5 bits 962,  Expect = 2e-81
 Identities = 137/146 93%, Positives = 144/146 98%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCR+ FITELSEFIPGASVRLQC++KENGD+TFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYT 60
Query  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
            RAEGLYSMLVERDHKNEFCEITLISSGRKDC+EIP EGWAKPSLKFIL+TVNGTTRTVNP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNP 120
Query  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146
            LGF+KKEALPKCAQVYNKLGMYPPNM
Sbjct  121  LGFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 6. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 287.0 bits 940,  Expect = 1e-79
 Identities = 133/146 91%, Positives = 141/146 96%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GASVRLQC+DKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
Query  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
            R EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGW KPSLKFIL+TVNGTTRT+NP
Sbjct  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
Query  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146
            LGF+KKEALP+CAQVYNKLGMYPPNM
Sbjct  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 7. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 280.7 bits 919,  Expect = 1e-77
 Identities = 128/145 88%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVSQFHIQGQVYCDTCRA FITELSEFIPGASVRLQCKD ENG +TFTE+GYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGW KPSLKF+L+TVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 8. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 276.8 bits 906,  Expect = 2e-76
 Identities = 126/145 86%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVSQF+IQGQVYCDTCRA FITELSEFIPGA VRLQCKD ENG +TFTE+GYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIP EGW KPSLKF+L+TVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 9. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 276.2 bits 904,  Expect = 3e-76
 Identities = 126/145 86%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVS F++QGQVYCDTCRAGFITELSEFI GA VRLQCKDKENG VTFTE+GYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKFIL+TVNGTTRT+NPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKE LPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 10. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 275.6 bits 902,  Expect = 4e-76
 Identities = 126/145 86%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVS F++QGQVYCDTCRAGFITELSEFI GA VRLQCK+KENG VTFTE+GYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKFIL+TVNGTTRT+NPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 11. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 275.0 bits 900,  Expect = 6e-76
 Identities = 123/145 84%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA VRLQCKD ENG +TFTE+GYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGW KPS+KFIL+TVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF+KKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 12. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 275.0 bits 900,  Expect = 6e-76
 Identities = 126/145 86%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            EDVPQPPVSQF+IQGQVYCDTCRA FITELSEFIPGA VRLQCKD ENG VTFTE+GYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
            AEGLY+ML+ERDHKNEFCEITLISS RKDC+EIPTEGW KPSLKF+L+TVNGTTRT+NPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  122  GFYKKEALPKCAQVYNKLGMYPPNM 146
            GF KKE LPKC QV+NKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 262.8 bits 859,  Expect = 2e-72
 Identities = 123/130 94%, Positives = 129/130 99%, Gaps = 0/130 0%
Query  17   QVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVERDHKN 76
            QVYCDTCRAGFITELSEFIPGASVRLQCK+K+NGD+TFTE+GYTRAEGLYSMLVERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  77   EFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPLGFYKKEALPKCAQVY 136
            EFCEITLISSG KDCNEIPTEGWAKPSLKFIL+TVNGTTRTVNPLGF+KKEALPKCAQVY
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  137  NKLGMYPPNM 146
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 142.9 bits 459,  Expect = 4e-36
 Identities = 70/141 49%, Positives = 94/141 66%, Gaps = 4/141 2%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+C++   G  TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTV 118
              G YS+ V+ DH+++ CEI L+ S    C+EIP + +AK S K  L++ NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  119  NPLGFYKKEALPKCAQVYN-KLGMY 142
            N LGF +KE LP+C +V   KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 132.1 bits 423,  Expect = 6e-33
 Identities = 66/141 46%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
            +DV +PPVSQFHIQG VYCDTCR  F+T +S  + GA+V+L+C++   G  TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTV 118
              G YS+ V  D +++ CEI L+ S   DC+EIP + +AK S K  L++ NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  119  NPLGFYKKEALPKCAQVYNK-LGMY 142
            N LGF +KE L +C +V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 127.2 bits 407,  Expect = 2e-31
 Identities = 61/142 42%, Positives = 90/142 63%, Gaps = 3/142 2%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
            ++DV + PVSQFHIQG VYCDTCR  F+T +S  + GA+V+L+C++   G  TF     T
Sbjct  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
Query  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RT 117
               G YS+ V  D +++ CEI L+ S   +C+E+  + +AK S K  L++ NG     R+
Sbjct  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
Query  118  VNPLGFYKKEALPKCAQVYNKLGMY 142
             N LGF +KE L +C +V  +L +Y
Sbjct  139  ANALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 17. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 119.5 bits 381,  Expect = 4e-29
 Identities = 54/131 41%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
            +H++G VYCDTCR  FIT +S  + GA+V LQC++   G  TF     T   G+Y++ V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTVNPLGFYKKEA 128
             DH+++ C+I L+ S  ++C+EIP + +++ + K  L++ NG     R  N LGF KK  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  129  LPKCAQVYNKLGMY 142
            LP+C +V  +L MY
Sbjct  129  LPECPEVLKELDMY 142

Sequence Alignment: 18. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 112.5 bits 358,  Expect = 5e-27
 Identities = 58/139 41%, Positives = 88/139 63%, Gaps = 8/139 5%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCR--AGFITELSEFIPGASVRLQCKDKENGDVTFTEIG 58
            ++DV + PVSQFHIQG VYCDTC   + ++  + E   GA+V+L+C++   G  TF    
Sbjct  19   LDDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEA 75
Query  59   YTRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT--- 115
             T   G YS+ V+ D +++ CEI L+ S    C+E+  + +AK S K  L++ NG     
Sbjct  76   VTDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDV 135
Query  116  RTVNPLGFYKKEALPKCAQVYNKLGMY 142
            R+ N LGF +KE L +C +V  +L +Y
Sbjct  136  RSANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 19. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 111.6 bits 355,  Expect = 1e-26
 Identities = 53/133 39%, Positives = 82/133 61%, Gaps = 3/133 2%
Query  10   SQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSML 69
            ++F +QG VYCDTCR  F+T +S  + GA+V+L+C++   G  TF     T   G YS+ 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  70   VERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTVNPLGFYKK 126
            V  D +++ CEI L+ S   +C+E+  + +AK S K  L++ NG     R+ N LGF +K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  127  EALPKCAQVYNKLGMY 142
            E L +C +V  +L +Y
Sbjct  148  EPLKECPEVLKELDLY 163

Sequence Alignment: 20. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 111.3 bits 354,  Expect = 1e-26
 Identities = 53/135 39%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  6    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGL 65
            +P V  F ++G+VYCDTCR  F T+LSE + GA+V+LQC++      TF+  G T  +G 
Sbjct  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
Query  66   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILST-VNGTTRTVNPLGFY 124
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   +  ++   R  NPL F 
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
Query  125  KKEALPKCAQVYNKLGMYP 143
            K E++  C +  ++LG++P
Sbjct  140  KAESVQGCKEALDELGLFP 158

Sequence Alignment: 21. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 92.4 bits 290,  Expect = 5e-21
 Identities = 53/119 44%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  10   SQFHIQGQVYCDTCRA-GFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSM 68
            ++FH++G+VYC+ C +  +I ELSE + GA V+L CKD ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
Query  69   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFILS---TVNGTTRTVNPLGF 123
             V   H++  CEI L+ SGR DC+EIP   +G  + S K  LS   T+   TR V PL F
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  124  YKKEALPKC 132
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 22. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 90.3 bits 283,  Expect = 2e-20
 Identities = 52/119 43%, Positives = 76/119 63%, Gaps = 10/119 8%
Query  10   SQFHIQGQVYCDTCRA-GFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSM 68
            ++FH++G+VYC+ C +  +I ELSE + GA V+L CKD ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRL 65
Query  69   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFILS---TVNGTTRTVNPLGF 123
             V   H++  CEI L+ S R DC+EIP   +G  + S K  LS   T+   TR V PL F
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  124  YKKEALPKC 132
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 23. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 89.7 bits 281,  Expect = 3e-20
 Identities = 42/124 33%, Positives = 66/124 53%, Gaps = 1/124 0%
Query  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
            F + G+VYCD CRAGF T +S  + GA+V + C+  + G+  +     T  +G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  72   RDHKNEFCEITLISSGRKDCNEIPT-EGWAKPSLKFILSTVNGTTRTVNPLGFYKKEALP 130
            +DH+ E CE+ L  S  K C+EI      A+  L           R  NP+ F++KE L 
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK 125
Query  131  KCAQV 135
            +C  +
Sbjct  126  ECGGI 130

Sequence Alignment: 24. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 86.6 bits 271,  Expect = 3e-19
 Identities = 42/121 34%, Positives = 67/121 55%, Gaps = 7/121 5%
Query  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE 71
            F + G+VYCD CRAGF T +S  + GA+V + C+    G+  +     T   G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT----RTVNPLGFYKKE 127
            +DH+ E CE+ L  S    C+EI      +   +  L++ NG      R  NP+ F++KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  128  ALPKCAQV 135
             L +C  +
Sbjct  123  PLKECGGI 130

Sequence Alignment: 25. Allergen Name: Scy p 9.0101 Sequence ID: QFI57017

 Score = 34.6 bits 103,  Expect = 0.008
 Identities = 25/55 45%, Positives = 32/55 58%, Gaps = 5/55 9%
Query  11   QFHIQGQVYCDTCRAGFITELSEFIPGAS-VRLQCKDKENGDVTFTEIGYTRAEGLYSML 69
            Q H + Q   DT  AG+   LS  I G S   +QCKD E+G +T   IGYT  E  Y ++
Sbjct  259  QTHKENQFTIDTRDAGY-GGLSLSIEGPSKADIQCKDNEDGTLT---IGYTPTEPGYYII 314

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.