The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT
RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP
LGFFKKEALPQCAQVYNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ83588 Fra e 1.0201 146 1010 307.3 1e-85
CAA73036 Ole e 1.0107 146 954 290.6 1.1e-80
X76395 Ole e 1.0102 145 943 287.3 1.1e-79
CAA73037 Ole e 1.0106 146 940 286.4 2.1e-79
CAA73038 Ole e 1.0105 146 935 284.9 5.8e-79
P19963 Ole e 1 145 929 283.2 2e-78
X76396 Ole e 1.0103 145 914 278.7 4.4e-77
CAA54819 Lig v 1.0102 145 909 277.2 1.3e-76
X76397 Ole e 1.0104 145 891 271.8 5.2e-75
AAQ08947 Fra e 1.0101 145 887 270.6 1.2e-74
AAV74343 Fra e 1.0102 145 885 270.0 1.8e-74
O82015 Lig v 1 145 883 269.4 2.7e-74
AAB32652 Ole e 1.0101 130 811 248.0 6.9e-68
A0A0K1SC24 Aca f 1 150 444 138.2 8.6e-35
AKV72167 Pro j 1.0101 150 420 131.1 1.2e-32
A0A0K1SC10 Ama r 1.0101 168 404 126.2 4.1e-31
ADK22842 Sal k 5.0101 151 380 119.1 5e-29
CAA33854 Lyc e LAT52 161 368 115.5 6.6e-28
A0A0K1SC44 Koc s 1.0101 167 354 111.3 1.3e-26
AAL07319 Che a 1 168 352 110.7 1.9e-26
CAC41635 Pla l 1.0103 131 283 90.3 2.1e-20
P82242 Pla l 1 131 276 88.2 9e-20
AAN32987 Phl p 11.0101 143 273 87.2 1.9e-19
Q7M1X5 Lol p 11.0101 134 272 86.9 2.1e-19
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 307.3 bits 1010,  Expect = 1e-85
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
Query  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
            RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP
Sbjct  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
Query  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146
            LGFFKKEALPQCAQVYNKLGMYPPNM
Sbjct  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 2. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 290.6 bits 954,  Expect = 1e-80
 Identities = 134/146 91%, Positives = 143/146 97%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCR+RFIT+LSEFI GASVRLQCR+KENGD+TFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYT 60
Query  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
            R EGLYSM+VERDHKNEFCEITL+SSGRKDC+EIPIEGW KPSLKFILNTVNGTTRT+NP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNP 120
Query  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146
            LGFFKKEALP+CAQVYNKLGMYPPNM
Sbjct  121  LGFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 3. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 287.3 bits 943,  Expect = 1e-79
 Identities = 133/145 91%, Positives = 141/145 97%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GAS+RLQC+DKENGDVTFTE+GYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGWVKPSLKFILNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+CAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 4. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 286.4 bits 940,  Expect = 2e-79
 Identities = 133/146 91%, Positives = 141/146 96%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GASVRLQC+DKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
            R EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGW KPSLKFIL+TVNGTTRT+NP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNP 120
Query  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146
            LGF+KKEALP+CAQVYNKLGMYPPNM
Sbjct  121  LGFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 5. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 284.9 bits 935,  Expect = 6e-79
 Identities = 133/146 91%, Positives = 140/146 95%, Gaps = 0/146 0%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
            MEDVPQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GASVRLQC+DKENGDVTFTEIGYT
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINP 120
            R EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGW KPSLKFILNTVNGTTRT+NP
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNP 120
Query  121  LGFFKKEALPQCAQVYNKLGMYPPNM 146
            L F+KKEALP+CAQVYNKLGMYPPNM
Sbjct  121  LRFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 6. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 283.2 bits 929,  Expect = 2e-78
 Identities = 130/145 89%, Positives = 139/145 95%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            ED+PQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GAS+RLQC+DKENGDVTFTE+GYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+CAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 7. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 278.7 bits 914,  Expect = 4e-77
 Identities = 126/145 86%, Positives = 139/145 95%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVSQFHIQGQVYCDTCRARFIT+LSEFI GASVRLQC+D ENG +TFTE+GYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM++ERDHK+EFCEITL+SS RKDC+EIP+EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+C QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 8. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 277.2 bits 909,  Expect = 1e-76
 Identities = 127/145 87%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVSQF+IQGQVYCDTCRARFIT+LSEFI GA VRLQC+D ENG +TFTE+GYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM++ERDHKNEFCEITLLSS RKDC+EIPIEGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+C QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 9. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 271.8 bits 891,  Expect = 5e-75
 Identities = 122/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPP+SQF++QGQVYCDTCR RFIT++SEFI GA VRLQC+D ENG +TFTE+GYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM++ERDHKNEFCEITLLSS RKDC+EIP EGWVKPS+KFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+C QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 10. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 270.6 bits 887,  Expect = 1e-74
 Identities = 125/145 86%, Positives = 133/145 91%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVS F++QGQVYCDTCRA FIT+LSEFI GA VRLQC+DKENG VTFTE+GYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM +ERDHKNEFCEI LLSS RKDC+EIP EGWVKPSLKFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKE LP+C QVYNKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 11. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 270.0 bits 885,  Expect = 2e-74
 Identities = 125/145 86%, Positives = 134/145 92%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVS F++QGQVYCDTCRA FIT+LSEFI GA VRLQC++KENG VTFTE+GYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLYSM +ERDHKNEFCEI LLSS RKDC+EIP EGWVKPSLKFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GFFKKEALP+C QVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 12. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 269.4 bits 883,  Expect = 3e-74
 Identities = 122/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            EDVPQPPVSQF+IQGQVYCDTCRARFIT+LSEFI GA VRLQC+D ENG VTFTE+GYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
             EGLY+M++ERDHKNEFCEITL+SS RKDC+EIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  122  GFFKKEALPQCAQVYNKLGMYPPNM 146
            GF+KKE LP+C QV+NKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 248.0 bits 811,  Expect = 7e-68
 Identities = 114/130 87%, Positives = 124/130 95%, Gaps = 0/130 0%
Query  17   QVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVERDHKN 76
            QVYCDTCRA FIT+LSEFI GASVRLQC++K+NGD+TFTE+GYTR EGLYSM+VERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  77   EFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPLGFFKKEALPQCAQVY 136
            EFCEITL+SSG KDCNEIP EGW KPSLKFILNTVNGTTRT+NPLGFFKKEALP+CAQVY
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  137  NKLGMYPPNM 146
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 138.2 bits 444,  Expect = 9e-35
 Identities = 69/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            +DVP+PPVSQFH+QG VYCDTCR  FIT+ S  + GA+V+L+CR+   G  TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTI 118
              G YS+ V+ DH+++ CEI L+ S    C+EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  119  NPLGFFKKEALPQCAQVYN-KLGMY 142
            N LGF +KE LP+C +V   KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 131.1 bits 420,  Expect = 1e-32
 Identities = 66/141 46%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
            +DV +PPVSQFHIQG VYCDTCR +F+T++S  + GA+V+L+CR+   G  TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTI 118
              G YS+ V  D +++ CEI L+ S   DC+EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  119  NPLGFFKKEALPQCAQVYNK-LGMY 142
            N LGF +KE L +C +V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 126.2 bits 404,  Expect = 4e-31
 Identities = 61/142 42%, Positives = 90/142 63%, Gaps = 3/142 2%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
            ++DV + PVSQFHIQG VYCDTCR +F+T++S  + GA+V+L+CR+   G  TF     T
Sbjct  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
Query  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RT 117
               G YS+ V  D +++ CEI L+ S   +C+E+  + + K S K  L + NG     R+
Sbjct  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
Query  118  INPLGFFKKEALPQCAQVYNKLGMY 142
             N LGF +KE L +C +V  +L +Y
Sbjct  139  ANALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 17. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 119.1 bits 380,  Expect = 5e-29
 Identities = 55/131 41%, Positives = 85/131 64%, Gaps = 3/131 2%
Query  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE 71
            +H++G VYCDTCR +FIT++S  + GA+V LQCR+   G  TF     T   G+Y++ V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  72   RDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTINPLGFFKKEA 128
             DH+++ C+I L+ S  ++C+EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  129  LPQCAQVYNKLGMY 142
            LP+C +V  +L MY
Sbjct  129  LPECPEVLKELDMY 142

Sequence Alignment: 18. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 115.5 bits 368,  Expect = 7e-28
 Identities = 56/135 41%, Positives = 87/135 64%, Gaps = 4/135 2%
Query  6    QPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGL 65
            +P V  F ++G+VYCDTCR +F TKLSE + GA+V+LQCR+      TF+  G T  +G 
Sbjct  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
Query  66   YSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNT-VNGTTRTINPLGFF 124
            Y + V  DH+N+ CE+T++ S R+DC E  + G+ K  ++   N  ++   R  NPL F 
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
Query  125  KKEALPQCAQVYNKLGMYP 143
            K E++  C +  ++LG++P
Sbjct  140  KAESVQGCKEALDELGLFP 158

Sequence Alignment: 19. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 111.3 bits 354,  Expect = 1e-26
 Identities = 59/139 42%, Positives = 86/139 61%, Gaps = 8/139 5%
Query  1    MEDVPQPPVSQFHIQGQVYCDTCR--ARFITKLSEFITGASVRLQCRDKENGDVTFTEIG 58
            ++DV + PVSQFHIQG VYCDTC   + ++  + E   GA+V+L+CR+   G  TF    
Sbjct  19   LDDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEA 75
Query  59   YTRGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT--- 115
             T   G YS+ V+ D +++ CEI LL S    C+E+  + + K S K  L + NG     
Sbjct  76   VTDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDV 135
Query  116  RTINPLGFFKKEALPQCAQVYNKLGMY 142
            R+ N LGF +KE L +C +V  +L +Y
Sbjct  136  RSANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 20. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 110.7 bits 352,  Expect = 2e-26
 Identities = 53/133 39%, Positives = 82/133 61%, Gaps = 3/133 2%
Query  10   SQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMF 69
            ++F +QG VYCDTCR +F+T++S  + GA+V+L+CR+   G  TF     T   G YS+ 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  70   VERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTINPLGFFKK 126
            V  D +++ CEI L+ S   +C+E+  + + K S K  L + NG     R+ N LGF +K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  127  EALPQCAQVYNKLGMY 142
            E L +C +V  +L +Y
Sbjct  148  EPLKECPEVLKELDLY 163

Sequence Alignment: 21. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 90.3 bits 283,  Expect = 2e-20
 Identities = 50/119 42%, Positives = 79/119 66%, Gaps = 10/119 8%
Query  10   SQFHIQGQVYCDTCRAR-FITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSM 68
            ++FH++G+VYC+ C +R +I +LSE + GA V+L C+D ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
Query  69   FVERDHKNEFCEITLLSSGRKDCNEIP--IEGWVKPSLKFILN---TVNGTTRTINPLGF 123
             V   H++  CEI L+ SGR DC+EIP   +G ++ S K  L+   T+   TR + PL F
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  124  FKKEALPQC 132
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 22. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 88.2 bits 276,  Expect = 9e-20
 Identities = 49/119 41%, Positives = 78/119 65%, Gaps = 10/119 8%
Query  10   SQFHIQGQVYCDTCRAR-FITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSM 68
            ++FH++G+VYC+ C +R +I +LSE + GA V+L C+D ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRL 65
Query  69   FVERDHKNEFCEITLLSSGRKDCNEIP--IEGWVKPSLKFILN---TVNGTTRTINPLGF 123
             V   H++  CEI L+ S R DC+EIP   +G ++ S K  L+   T+   TR + PL F
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  124  FKKEALPQC 132
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 23. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 87.2 bits 273,  Expect = 2e-19
 Identities = 44/121 36%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE 71
            F + G+VYCD CRA F T +S  + GA+V + CR    G+  +     T G G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  72   RDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT----RTINPLGFFKKE 127
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIE---EFRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  128  ALPQCAQV 135
             L +C  +
Sbjct  123  PLKECGGI 130

Sequence Alignment: 24. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 86.9 bits 272,  Expect = 2e-19
 Identities = 42/124 33%, Positives = 64/124 51%, Gaps = 1/124 0%
Query  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE 71
            F + G+VYCD CRA F T +S  + GA+V + CR  + G+  +     T  +G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  72   RDHKNEFCEITLLSSGRKDCNEIP-IEGWVKPSLKFILNTVNGTTRTINPLGFFKKEALP 130
            +DH+ E CE+ L  S  K C+EI       +  L           R  NP+ FF+KE L 
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK 125
Query  131  QCAQV 135
            +C  +
Sbjct  126  ECGGI 130

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.