The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLT
NDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFN
HDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHY
TQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK
Sequence Info Allergen Name Length Opt Bits Score E Value
P10736 Dol m 5.0101 227 1585 387.6 1.8e-109
P10737 Dol m 5.02 215 1201 295.4 9.6e-82
AAA28302 Dol m 5.02 212 1182 290.8 2.2e-80
Q05108 Dol a 5 203 1134 279.3 6.3e-77
Q05110 Ves v 5 227 1106 272.6 7.5e-75
P35781 Vesp c 5 202 1066 263.0 5.1e-72
P35787 Ves vi 5 206 1054 260.1 3.9e-71
P35782 Vesp c 5 202 1050 259.1 7.3e-71
P81657 Vesp m 5 202 1046 258.2 1.4e-70
P0DMB9 Vesp v 5.0101 202 1040 256.7 3.9e-70
P35786 Ves s 5 205 1018 251.4 1.5e-68
P35785 Ves p 5 204 1008 249.0 8.1e-68
P35783 Ves f 5 204 1003 247.8 1.9e-67
P35760 Ves m 5 204 995 245.9 7e-67
P35784 Ves g 5 204 985 243.5 3.7e-66
P81656 Pol d 5 206 937 232.0 1.1e-62
AAT95009 Pol e 5.0101 226 936 231.7 1.5e-62
P83377 Pol g 5 206 929 230.1 4.2e-62
Q7Z156 Poly s 5.0101 207 882 218.8 1.1e-58
Q05109 Pol a 5 209 882 218.8 1.1e-58
P35759 Pol e 5.0101 205 880 218.3 1.5e-58
C0HJV9 Poly p 5.0101 206 873 216.6 4.7e-58
P35780 Pol f 5 205 870 215.9 7.7e-58
P86686 Poly p 5.0102 207 860 213.5 4.1e-57
P35778 Sol i 3 234 696 174.1 3.4e-45
P35779 Sol r 3 211 669 167.6 2.7e-43
C0ITL3 Pac c 3.0101 199 662 166.0 8e-43
QEA69430 Sco m 5.0101 210 347 90.3 5e-20
AAF82096 Glo m 5 259 288 76.1 1.2e-15
AAF65314 Cte f 2 264 280 74.2 4.5e-15
ABC58726 Sol s 3.0101 90 247 66.5 3.3e-13
AAY32926 Sol g 3.0101 70 242 65.3 5.6e-13
ADM18345 Tab y 5.0101 256 236 63.6 6.7e-12
AAU15051 Cyn d 24.0101 153 191 52.9 6.6e-09
A0A2L1DGQ3 Art ar 2.0101 163 186 51.7 1.6e-08
AVD29827 Art si 2.0101 163 186 51.7 1.6e-08
AVD29822 Art an 2.0101 163 186 51.7 1.6e-08
AVD29826 Art la 2.0101 163 186 51.7 1.6e-08
AVD29824 Art ca 2.0101 163 186 51.7 1.6e-08
AVD29825 Art gm 2.0101 163 186 51.7 1.6e-08
7065471 Pol m 5.0101 37 154 44.3 6.2e-07
XP_007199020 Pru p 9.0101 161 135 39.5 7.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 387.6 bits 1585,  Expect = 2e-109
 Identities = 227/227 100%, Positives = 227/227 100%, Gaps = 0/227 0%
Query  1    MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLT 60
            MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLT
Sbjct  1    MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLT 60
Query  61   NDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFN 120
            NDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFN
Sbjct  61   NDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFN 120
Query  121  HDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHY 180
            HDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHY
Sbjct  121  HDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHY 180
Query  181  TQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK 227
            TQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK
Sbjct  181  TQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 2. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 295.4 bits 1201,  Expect = 1e-81
 Identities = 166/213 77%, Positives = 185/213 86%, Gaps = 1/213 0%
Query  15   IINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDF 74
            IINLSFGE NNYCKIKC +GIHTLCKFGTSMKPNCG  +VK +G++NDEKNEI+ RHN F
Sbjct  2    IINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQF 61
Query  75   RQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQ 134
            RQ VAKGLETRG PGPQPPAKNMNVLVWNDELAKIAQTWANQC F HD CRNT KYQVGQ
Sbjct  62   RQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQ 121
Query  135  NIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVG-LQNSNFRKVGHYTQMVWGKTKEIGC 193
            N+AI+STT   +   SKLI+ WE+EV +FN K G + ++NF KVGHYTQMVWGKTKEIGC
Sbjct  122  NVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGC 181
Query  194  GSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK 227
            GS+KYIE+NW+THYLVCNYGP GN  +QPIYERK
Sbjct  182  GSVKYIENNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 3. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 290.8 bits 1182,  Expect = 2e-80
 Identities = 163/210 77%, Positives = 182/210 86%, Gaps = 1/210 0%
Query  15   IINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDF 74
            IINLSFGE NNYCKIKC +GIHTLCKFGTSMKPNCG  +VK +G++NDEKNEI+ RHN F
Sbjct  2    IINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQF 61
Query  75   RQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQ 134
            RQ VAKGLETRG PGPQPPAKNMNVLVWNDELAKIAQTWANQC F HD CRNT KYQVGQ
Sbjct  62   RQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQ 121
Query  135  NIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVG-LQNSNFRKVGHYTQMVWGKTKEIGC 193
            N+AI+STT   +   SKLI+ WE+EV +FN K G + ++NF KVGHYTQMVWGKTKEIGC
Sbjct  122  NVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGC 181
Query  194  GSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GS+KYIE+NW+THYLVCNYGP GN  +QPIY
Sbjct  182  GSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 4. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 279.3 bits 1134,  Expect = 6e-77
 Identities = 155/203 76%, Positives = 175/203 86%, Gaps = 1/203 0%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NNYCKI C KG HTLCK+GTSMKPNCG  +VK+YG+TNDEKNEI+KRHN+FRQ VA+GLE
Sbjct  1    NNYCKI-CPKGTHTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGLE 59
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAKNMN+LVWNDELAKIAQTWANQC+F HD CRNTAKY VGQN+AI+STT 
Sbjct  60   TRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKYPVGQNVAIASTTG 119
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              +   S LIK WEDEV ++N    L ++NF KVGHYTQMVWGKTKEIGCGS+KYIE+ W
Sbjct  120  NSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKW 179
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            +THYLVCNYGP GN  NQP+YERK
Sbjct  180  HTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 5. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 272.6 bits 1106,  Expect = 8e-75
 Identities = 148/226 65%, Positives = 182/226 80%, Gaps = 2/226 0%
Query  1    MEIGGLVYLILIITIINLSFGETNNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGL 59
            MEI GLVYLI+I+TII+L +G+ NNYCKIKC KG +HT CK+G S+KPNCG  VV +YGL
Sbjct  1    MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGL 59
Query  60   TNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF 119
            T  EK +ILK HNDFRQ +A+GLETRG PGPQPPAKNM  LVWNDELA +AQ WANQC +
Sbjct  60   TKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQY 119
Query  120  NHDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGH 179
             HD CR+ AKYQVGQN+A++ +TA ++D P KL+K WEDEV ++N K  +  ++F K GH
Sbjct  120  GHDTCRDVAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGH 179
Query  180  YTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYERK 227
            YTQMVW  TKE+GCGSIKYI++ W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  180  YTQMVWANTKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 6. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 263.0 bits 1066,  Expect = 5e-72
 Identities = 147/202 72%, Positives = 167/202 82%, Gaps = 2/202 0%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NNYCKIKCR GIHTLCK+GTS KPNCG+NVVKA GLT  E  EILK+HN+FRQ VA+GLE
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAK+MN LVWNDELA+IAQ WANQC++ HD+CRN+AKY VGQNIA  STTA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTTA 120
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              F   S ++K WEDEV ++ Y  G   + + KVGHYTQMVW KTKEIGCGSIKYIE+ W
Sbjct  121  DNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            + HYLVCNYGP GN  N+PIYERK
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 7. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 260.1 bits 1054,  Expect = 4e-71
 Identities = 144/203 70%, Positives = 165/203 81%, Gaps = 1/203 0%
Query  25   NYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NYCKIKC KG +HT CK+GTS KPNCG+ VVKAYGLT  EK EILK HNDFRQ VAKGLE
Sbjct  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAKNMN LVWNDELA IAQ WA+QC++ HD C++T KY VGQNIA  STTA
Sbjct  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              FD P KL+K WE+EV +FN  +    +N++K GHYTQMVW KTKEIGCGS+KY++D W
Sbjct  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            YTHYLVCNYGP GN  N+ +YE+K
Sbjct  183  YTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 8. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 259.1 bits 1050,  Expect = 7e-71
 Identities = 145/202 71%, Positives = 165/202 81%, Gaps = 2/202 0%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NNYCKIKCR GIHTLCK+GTS KPNCG+NVVKA GLT  E  EILK+HN+FRQ VA+GLE
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAK+MN LVWNDELA+IAQ WANQC++ HD+CRN+AKY VGQNIA  ST+A
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTSA 120
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              F   S ++K WEDEV ++ Y  G   + + KVGHYTQMVW KTKEIGCGS  YIED W
Sbjct  121  DNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGW 178
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            + HYLVCNYGP GN  N+PIYERK
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 9. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 258.2 bits 1046,  Expect = 1e-70
 Identities = 146/202 72%, Positives = 165/202 81%, Gaps = 2/202 0%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NNYCKIKCR GIHTLCKFG S KPNCG+NVVKA GLT  EK EILK+HN+FRQ VA+GLE
Sbjct  1    NNYCKIKCRSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRGKPGPQPPAK+MN LVWNDELA+IAQ WA QCD+ HD CRNTAKY VGQNIA + +TA
Sbjct  61   TRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYSVGQNIAENGSTA 120
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              F   S +++ W DEV   NY+ G   + + +VGHYTQMVW KTKEIGCGSIKYIE+ W
Sbjct  121  ASFASVSNMVQMWADEVK--NYQYGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            + HYLVCNYGP GN  N+PIYERK
Sbjct  179  HRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 10. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 256.7 bits 1040,  Expect = 4e-70
 Identities = 144/202 71%, Positives = 166/202 82%, Gaps = 2/202 0%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            NNYCKIKCR GIHTLCK+GTS KPNCGR+VVKA GLT  EK EILK+HN+FRQ VA+GLE
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAK+MN LVWNDELA+IAQ WA+QC + HD+CRNTAKY VGQNIA  STTA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLVGQNIAEQSTTA 120
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              F+  S ++K W DEV ++ Y  G   + +  VGHYTQMVW KTKEIGCG+IKYIE+ W
Sbjct  121  ASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIENGW 178
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            + HYLVCNYGP GN  N+PIYE+K
Sbjct  179  HHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 11. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 251.4 bits 1018,  Expect = 2e-68
 Identities = 137/203 67%, Positives = 164/203 80%, Gaps = 1/203 0%
Query  25   NYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
            +YCKIKC KG +HT CK+GTS KPNCG  VVK+YG+T  EK EILK HNDFR  VA+GLE
Sbjct  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
Query  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
            TRG PGPQPPAKNMN LVWN+ELA IAQ WA+QC + HD C++T KY VGQNIA+SS+TA
Sbjct  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
Query  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
              ++    L+K WE+EV +FN  +  + + F+K+GHYTQMVW KTKEIGCGSIKY+++NW
Sbjct  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
Query  204  YTHYLVCNYGPGGNDFNQPIYERK 227
            YTHYLVCNYGP GN  NQ +YERK
Sbjct  182  YTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 12. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 249.0 bits 1008,  Expect = 8e-68
 Identities = 133/203 65%, Positives = 163/203 80%, Gaps = 2/203 0%
Query  24   NNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            NNYCKIKC KG +HT CK+G S+KPNCG  +V +YGLT +EK +ILK HNDFRQ +A+GL
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGL 59
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTT 142
            ETRG PGPQPPAKNM  LVWNDELA +AQ WANQC + HD CR+ AKY VGQN+A++ +T
Sbjct  60   ETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYPVGQNVALTGST 119
Query  143  ATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDN 202
            A ++D P KL+K WEDEV ++N K  +  +NF K+GHYTQMVW  TKEIGCGSIKYI++ 
Sbjct  120  ADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQNE 179
Query  203  WYTHYLVCNYGPGGNDFNQPIYERK 227
            W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  180  WHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 13. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 247.8 bits 1003,  Expect = 2e-67
 Identities = 133/203 65%, Positives = 162/203 79%, Gaps = 2/203 0%
Query  24   NNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            NNYCKIKC KG +HT CK+G S+KPNCG  VV +YGLT  EK +ILK HNDFRQ +A+GL
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTT 142
            ETRG PGPQPPAKNM  LVWNDELA +AQ WANQC + HD CR+ AKYQVGQN+A++ +T
Sbjct  60   ETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQVGQNVALTGST 119
Query  143  ATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDN 202
            A ++D P KL+K WEDEV ++N K  +  +NF K GHYTQMVW  TKE+GCGSIK+I++ 
Sbjct  120  AAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEK 179
Query  203  WYTHYLVCNYGPGGNDFNQPIYERK 227
            W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  180  WHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 14. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 245.9 bits 995,  Expect = 7e-67
 Identities = 133/203 65%, Positives = 162/203 79%, Gaps = 2/203 0%
Query  24   NNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            NNYCKIKC KG +HT CK+G S+KPNCG   V +YGLT  EK +ILK HNDFRQ +A+GL
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTT 142
            ETRG PGPQPPAKNM  LVW+DELA IAQ WANQC + HD CR+ AKYQVGQN+A++ +T
Sbjct  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
Query  143  ATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDN 202
            A  ++ P KL+K WEDEV ++N K  +  +NF K+GHYTQMVW  TKE+GCGSIKYI++N
Sbjct  120  AAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQEN 179
Query  203  WYTHYLVCNYGPGGNDFNQPIYERK 227
            W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  180  WHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 15. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 243.5 bits 985,  Expect = 4e-66
 Identities = 132/203 65%, Positives = 159/203 78%, Gaps = 2/203 0%
Query  24   NNYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            NNYCKIKC KG +HT CK+  S+KPNC    V AYGLT  EK +ILK HNDFRQ +A+GL
Sbjct  1    NNYCKIKCLKGGVHTACKY-ESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTT 142
            ETRG PGPQPPAKNM  LVW+DELA IAQ WANQC + HD CR+ AKY VGQN+A++ +T
Sbjct  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYPVGQNVALTGST 119
Query  143  ATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDN 202
            A ++D P KL+K WEDEV ++N K  +  +NF K+GHYTQMVW  TKE+GCGSIKYI+D 
Sbjct  120  AAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQDK 179
Query  203  WYTHYLVCNYGPGGNDFNQPIYERK 227
            W+ HYLVCNYGP GN  N+ +Y+ K
Sbjct  180  WHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 16. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 232.0 bits 937,  Expect = 1e-62
 Identities = 129/203 63%, Positives = 157/203 77%, Gaps = 4/203 1%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKG 81
            N+YCKIKC  G+HT+C++G S KP  NC   ++K+ G T +EK  I++ HN FRQ VAKG
Sbjct  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
Query  82   LETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISS 140
            LETRG PGPQP A NMN LVWNDELAKIAQ WA+QC  + HD CRNT KYQVGQNIA + 
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  141  TTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIE 200
            ++  +F   +KLI+ WE+EV +FNY  G+ N NF KVGHYTQMVWG TKE+GCGS+KY+E
Sbjct  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  201  DNWYTHYLVCNYGPGGNDFNQPIYERK 227
             N   HYL+CNYGP GN + QPIY +K
Sbjct  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 17. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 231.7 bits 936,  Expect = 1e-62
 Identities = 134/217 61%, Positives = 164/217 75%, Gaps = 7/217 3%
Query  1    MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYG 58
            MEIGGLVYL++++ II+ S G   +YCKI+C  GIHT+C++G S KP  NC   V+K+ G
Sbjct  1    MEIGGLVYLVIVVAIIHSSQG--VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 58
Query  59   LTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD 118
             T +EK  I+  HN FRQ VA+GLETRG PGPQP A +MN LVWNDELA IAQ WA+QC 
Sbjct  59   PTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQ 118
Query  119  F-NHDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKV 177
            F  HD CRNTAKY VGQNIA +    +++     LIK WE+EV +FNY  G+   NF K+
Sbjct  119  FLVHDKCRNTAKYPVGQNIAYAG--GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 176
Query  178  GHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQ 221
            GHYTQMVWGKTKEIGCGS+KY+E+    HYL+CNYGP GN + Q
Sbjct  177  GHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQ 220

Sequence Alignment: 18. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 230.1 bits 929,  Expect = 4e-62
 Identities = 128/203 63%, Positives = 156/203 76%, Gaps = 4/203 1%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKG 81
            N+YCKIKC  G+HT+C++G S KP  NC   V+K+ G T +EK  I++ HN FRQ VA+G
Sbjct  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQG 60
Query  82   LETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISS 140
            LETRG PGPQP A NMN LVWNDE AKIAQ WA+QC  + HD CRNT KYQVGQNIA + 
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  141  TTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIE 200
            ++  +F   +KLI+ WE+EV +FNY  G+ N NF KVGHYTQMVWG TKE+GCGS+KY+E
Sbjct  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  201  DNWYTHYLVCNYGPGGNDFNQPIYERK 227
             N   HYL+CNYGP GN + QPIY +K
Sbjct  180  KNMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 19. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 218.8 bits 882,  Expect = 1e-58
 Identities = 127/203 62%, Positives = 149/203 73%, Gaps = 5/203 2%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKP---NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAK 80
            N YC IKC K  HT+C++G S KP   NC +  + + G+T +EK  I+  HN FRQ VA+
Sbjct  1    NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 60
Query  81   GLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAIS 139
            GLETRG PGPQP A +MN LVWNDELA IAQ WANQC F  HD CRNTA+YQVGQNIA S
Sbjct  61   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYS 120
Query  140  STTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYI 199
            ++TA  +     LI  WE+EV +FNY  G+   NF KVGHYTQ+VW KTKE+GCGSIKYI
Sbjct  121  ASTAA-YPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYI 179
Query  200  EDNWYTHYLVCNYGPGGNDFNQPIYERK 227
            E    +HYLVCNYGP GN   QPIY +K
Sbjct  180  EKGMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 20. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 218.8 bits 882,  Expect = 1e-58
 Identities = 125/201 62%, Positives = 149/201 74%, Gaps = 5/201 2%
Query  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISST 141
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTAKY VGQNIA +  
Sbjct  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 124
Query  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
              + +     LIK WE+EV +FNY  G+   NF K+GHYTQMVWGKTKEIGCGS+KY+E+
Sbjct  125  -GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMEN 183
Query  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227
            N   HYL+CNYGP GN + Q  Y +K
Sbjct  184  NMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 21. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 218.3 bits 880,  Expect = 1e-58
 Identities = 125/201 62%, Positives = 149/201 74%, Gaps = 5/201 2%
Query  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISST 141
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTAKY VGQNIA +  
Sbjct  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG- 120
Query  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
              +++     LIK WE+EV +FNY  G+   NF K+GHYTQMVWGKTKEIGCGS+KYIE+
Sbjct  121  -GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIEN 179
Query  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227
                HYL+CNYGP GN + Q  Y +K
Sbjct  180  KMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 22. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 216.6 bits 873,  Expect = 5e-58
 Identities = 125/203 61%, Positives = 149/203 73%, Gaps = 4/203 1%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKPN--CGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKG 81
            N YC IKC K  HT+C++G S KP+  C +  + + G+T +EK  I+  HN FRQ VA+G
Sbjct  1    NKYCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 60
Query  82   LETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAISS 140
            LETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTA+YQVGQNIA S+
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSA 120
Query  141  TTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIE 200
            +TA  +     LI  WE+EV +FNY  G+   NF KVGHYTQ+VW KTKE+GCGSIKYIE
Sbjct  121  STAA-YPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIE 179
Query  201  DNWYTHYLVCNYGPGGNDFNQPIYERK 227
                +HYLVCNYGP GN   QPIY +K
Sbjct  180  KGMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 23. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 215.9 bits 870,  Expect = 8e-58
 Identities = 123/201 61%, Positives = 150/201 74%, Gaps = 5/201 2%
Query  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
Query  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISST 141
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC  + HD CRNTAKYQVGQNIA +  
Sbjct  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
Query  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
              +++     LIK WE+EV +FNY  G+   NF KVGHYTQM+W KTKEIGCGS+KY+++
Sbjct  121  -GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
Query  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227
            N   HYL+CNYGP GN + Q  Y +K
Sbjct  180  NMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 24. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 213.5 bits 860,  Expect = 4e-57
 Identities = 126/203 62%, Positives = 148/203 72%, Gaps = 5/203 2%
Query  24   NNYCKIKCRKGIHTLCKFGTSMKP---NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAK 80
            N YC IKC K  HT+C+ G S KP   NC +  + + G+T +EK  I+  HN FRQ VA+
Sbjct  1    NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 60
Query  81   GLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDF-NHDDCRNTAKYQVGQNIAIS 139
            GLETRG PGPQP A +MN LVWNDELA IAQ WA+QC F  HD CRNTA+YQVGQNIA S
Sbjct  61   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS 120
Query  140  STTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYI 199
            ++TA  +    KLI  WE+EV +FNY  G+   NF KVGHYTQ+VW KTKE+GCGSIKYI
Sbjct  121  ASTAA-YPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYI 179
Query  200  EDNWYTHYLVCNYGPGGNDFNQPIYERK 227
            E    +HYLVCNYGP GN +   IYE K
Sbjct  180  EKGMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 25. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 174.1 bits 696,  Expect = 3e-45
 Identities = 106/217 48%, Positives = 142/217 65%, Gaps = 11/217 5%
Query  9    LILIITIINLSFGETNNYCKIK-CRKG--IHTLCKFGTSMK-PNCGRNVVKAYGLTNDEK 64
            L L IT  NL+     NYC ++ C++   IHT+C++ +    P C        G+T+ EK
Sbjct  8    LWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEK 65
Query  65   NEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDC 124
            + I+ +HN++RQ VA G E RG  GPQPPA  M  L W+ ELA IAQ WANQC F HD C
Sbjct  66   DAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDAC 125
Query  125  RNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYK----VGLQNSNFRKVGHY 180
            RN  ++ VGQNIA +S++      P+++I  W +EV +F+ +        ++ + KVGHY
Sbjct  126  RNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHY 185
Query  181  TQMVWGKTKEIGCGSIKYIE-DNWYTHYLVCNYGPGGNDFNQPIYERK 227
            TQ+VW KT +IGCG I + E DNW  HYLVCNYGP GN +  PIYE K
Sbjct  186  TQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 167.6 bits 669,  Expect = 3e-43
 Identities = 100/201 49%, Positives = 133/201 66%, Gaps = 10/201 4%
Query  25   NYCKIK-CRKG--IHTLCKFGTSMK-PNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAK 80
            NYC ++ C++   IHT+C++ +    P C        G+T+ EK+ I+ +HN++RQ VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  81   GLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISS 140
            G E RG  GPQPPA  M  L W+ ELA IAQ WANQC F HD CRN  ++ VGQNIA +S
Sbjct  60   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 119
Query  141  TTATQFDRPSKLIKQWEDEVTEFNYK-VGLQNSN---FRKVGHYTQMVWGKTKEIGCGSI 196
            ++       S +I  W +EV +F+ + +    S+   +  VGHYTQ+VW KTK+IGCG I
Sbjct  120  SSGKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRI 179
Query  197  KYIEDNWYTHYLVCNYGPGGNDFNQPIYERK 227
             + EDNW  HYLVCNYGP GN +   IYE K
Sbjct  180  MFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 166.0 bits 662,  Expect = 8e-43
 Identities = 97/189 51%, Positives = 126/189 66%, Gaps = 7/189 3%
Query  35   IHTLCKFGTSM-KPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPP 93
            +HT+C++ +    PNCG     A+ +T  +K  ILK HND RQ V  G ETRG PGPQP 
Sbjct  6    VHTMCQYTSPQPSPNCG-TYSNAH-ITAADKETILKVHNDERQKVKAGQETRGNPGPQPA 63
Query  94   AKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTATQFDRPSKLI 153
            A NM  L W++ELA IAQ W NQC   HD CRN  +YQVGQNIA+S +TA      + L+
Sbjct  64   ASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNNLV 123
Query  154  KQWEDEVTEFNYK-VGLQNSN---FRKVGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLV 209
            + W +EV  +N   V    S+   F K+GHYTQ+VWGKT ++GCG I++++  +Y  YL 
Sbjct  124  QMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCYLA 183
Query  210  CNYGPGGNDFNQPIYE 225
            CNYGP GN F  PIY+
Sbjct  184  CNYGPAGNMFGAPIYQ 199

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 90.3 bits 347,  Expect = 5e-20
 Identities = 68/158 43%, Positives = 93/158 58%, Gaps = 22/158 13%
Query  54   VKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTW 113
            +K  GL  + K  IL  HN  RQ VA G ++ G    QP A NM  L W+D++A  AQ  
Sbjct  26   MKVRGLDANMKKMILDLHNKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRS 80
Query  114  ANQCDFNHD--DCRNTAKYQ-VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQ 170
            A  C F H   + R T+KY  +G+NI + S      D   + +  W DEV +    V   
Sbjct  81   AETCVFQHTAKNLRKTSKYSYLGENIYMGSYP----DPIPRSVNAWYDEVKDVTPAV--- 133
Query  171  NSNFRK----VGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYER 226
              +FR     +GHYTQMVW  T+ +GCG +   + N    Y+ C YGP GN   +PIY++
Sbjct  134  VKSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKN---TYIFCQYGPSGNYPGEPIYKQ 190

Sequence Alignment: 29. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 76.1 bits 288,  Expect = 1e-15
 Identities = 68/188 36%, Positives = 103/188 54%, Gaps = 24/188 12%
Query  25   NYCKIKCRKGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLET 84
            +YC + C    H  C      +  C     K   L N  ++ +L  HN  R +VA G E+
Sbjct  21   DYCGL-CDN--HDACVMQNVFQSGCPSGA-KMIDL-NKYQSALLDAHNKKRNHVAGGGES 75
Query  85   RGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ-VGQNIAISSTTA 143
            + K   Q     M  + W+ ELAK+A+    QC  NHD CRNT K++  GQN+A    + 
Sbjct  76   KLKRACQ-----MATMKWDSELAKLAEYNVKQCQMNHDRCRNTVKFKYAGQNLAELGRSG 130
Query  144  TQFDRPSKLIKQ----WEDEVTEFNYKVGLQNS---NFR--KVGHYTQMVWGKTKEIGCG 194
                   KLI++    W +EV + N   G  +S   N+R   +GH+T MV  +   +GC 
Sbjct  131  GPPPDYRKLIEKAVDKWYEEVKDCNQ--GYIDSYPMNYRGPAIGHFTVMVAERNTHVGCA 188
Query  195  SIKYIEDNWYTHYLV-CNYGPGGNDFNQPIYE 225
            + +Y + N + ++L+ CNY    N    PIY+
Sbjct  189  ASEYTKSNGFQYFLMACNYATT-NMMEFPIYK 219

Sequence Alignment: 30. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 74.2 bits 280,  Expect = 5e-15
 Identities = 73/211 34%, Positives = 109/211 51%, Gaps = 26/211 12%
Query  7    VYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCGRNV--VKAYGLTNDEK 64
            V+L +I  +        ++YC + C  G +  C      KP+  R+    K   +T   K
Sbjct  15   VWLSVIFAVNVKPKPNQDDYCNLNCTNGPNVGCT-----KPDVPRDCQNFKLVNITERMK 69
Query  65   NEILKRHNDFRQNVAKGLETRG--KPGPQPP-AKNMNVLVWNDELAKIAQTWANQCDFNH 121
               L  HN  R+ VA G   +G  K G + P A  M  L WN  LAK+A+    QC+  H
Sbjct  70   KAFLNAHNRKRRLVAAG---KGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCEMKH 126
Query  122  DDCRNTAKYQVGQNIAISSTTATQFDRPS--KL-IKQW----EDEVTEFNYKVGLQNSNF 174
            D C  T   + GQN+    TT +     +  K+ +  W    +D   E   K+     N 
Sbjct  127  D-CAKTRHGHTGQNLFFYGTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNG 185
Query  175  RKVGHYTQMVWGKTKEIGCGSIKYIED---NWYTHYLV-CNYGPGGNDFNQPIYERK 227
            + +GHYTQ++WG T ++GC    Y +    N +   LV CNY  GGN + + +Y+ K
Sbjct  186  KPIGHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 66.5 bits 247,  Expect = 3e-13
 Identities = 39/85 45%, Positives = 55/85 64%, Gaps = 6/85 7%
Query  25   NYCKIK-CRKG--IHTLCKFGTSMK-PNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAK 80
            NYC ++ C++   IHT+C++ +    P C        G+T+ EK+ I+ +HN++RQ VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  81   GLETRGKPGPQPPAKNMNVLVWNDELAKIAQ 111
            G E RG   PQPPA  M  L W+ ELA IAQ
Sbjct  60   GKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 65.3 bits 242,  Expect = 6e-13
 Identities = 34/52 65%, Positives = 39/52 75%, Gaps = 1/52 1%
Query  176  KVGHYTQMVWGKTKEIGCGSIKYIE-DNWYTHYLVCNYGPGGNDFNQPIYERK 227
            K+GHYTQ+VW KT +IGCG I + E DNW  HYLVCNYGP GN +   IYE K
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 63.6 bits 236,  Expect = 7e-12
 Identities = 56/207 27%, Positives = 99/207 47%, Gaps = 18/207 8%
Query  9    LILIITIINLSFGETNNYCKIKCR--KGIHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNE 66
            L+L++ ++  S   + +YC + CR  +G H  C        +CG+   +   +T + K  
Sbjct  9    LLLVVLVLQCSVINSLDYCSL-CRGGRGEHVGCG-SPGFSSDCGQKA-RTRKFTKEHKKV 65
Query  67   ILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRN 126
            IL + ND R +VAKG  + G     P A  M V+VW++ELA +A+     C      CR+
Sbjct  66   ILDKINDVRDHVAKG--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRH 119
Query  127  TAKYQV-GQ-NIAI-SSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQM 183
            T ++   GQ N    +    +     S  IK+   +       +  +       G+  ++
Sbjct  120  TLRFWSPGQLNFEFYADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKEL 179
Query  184  ---VWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYE 225
               +  +   +GCG   +         L CN+    ND+N+P+Y+
Sbjct  180  ALAISDRVTAVGCGLTTWKLGGKARALLTCNFS-SENDYNRPVYK 223

Sequence Alignment: 34. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 52.9 bits 191,  Expect = 7e-09
 Identities = 48/141 34%, Positives = 70/141 49%, Gaps = 27/141 19%
Query  58   GLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQC 117
            GL +    +IL  HN FR   AK           PP      L WN  LAK +Q +A   
Sbjct  12   GLNDKAIQDILNEHNMFR---AKE--------HVPP------LTWNTTLAKFSQDYAESK 54
Query  118  DFNHDDCRNT-AKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRK 176
                 DC+   +    G+N+   S   +        +  W DE   ++Y     +   + 
Sbjct  55   --LKKDCKMVHSDSPYGENLMFGSGAISW----KTTVDTWSDEKKSYHYGSNTCDQG-KM 107
Query  177  VGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
             GHYT +VW  T  +GCG +  + D+     ++C+Y P GN  NQ  Y
Sbjct  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 51/128 39%, Positives = 75/128 58%, Gaps = 25/128 19%
Query  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
Query  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  ++ +
Sbjct  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANSERV 132
Query  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GCG  + +  N + + +VCNY P GN   Q  Y
Sbjct  133  GCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 51/128 39%, Positives = 75/128 58%, Gaps = 25/128 19%
Query  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---EARTADCSLVHSDR 81
Query  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  ++ +
Sbjct  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANSERV 132
Query  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GCG  + +  N + + +VCNY P GN   Q  Y
Sbjct  133  GCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 52/128 40%, Positives = 74/128 57%, Gaps = 25/128 19%
Query  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLVHSDR 81
Query  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  T+ +
Sbjct  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANTERV 132
Query  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GCG  + +  N + +  VCNY P GN   Q  Y
Sbjct  133  GCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 51/128 39%, Positives = 75/128 58%, Gaps = 25/128 19%
Query  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
Query  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  ++ +
Sbjct  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANSERV 132
Query  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GCG  + +  N + + +VCNY P GN   Q  Y
Sbjct  133  GCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 50/127 39%, Positives = 74/127 58%, Gaps = 25/127 19%
Query  84   TRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQV 132
            T G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      + 
Sbjct  26   TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDRC 82
Query  133  GQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIG 192
            G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  ++ +G
Sbjct  83   GENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANSERVG 133
Query  193  CGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            CG  + +  N + + +VCNY P GN   Q  Y
Sbjct  134  CG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 51.7 bits 186,  Expect = 2e-08
 Identities = 52/128 40%, Positives = 74/128 57%, Gaps = 25/128 19%
Query  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLVHSDR 81
Query  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  T+ +
Sbjct  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANTERV 132
Query  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224
            GCG  + +  N + +  VCNY P GN   Q  Y
Sbjct  133  GCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 41. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 44.3 bits 154,  Expect = 6e-07
 Identities = 20/34 58%, Positives = 26/34 76%, Gaps = 2/34 5%
Query  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYG 58
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G
Sbjct  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 39.5 bits 135,  Expect = 8e-05
 Identities = 49/130 37%, Positives = 73/130 56%, Gaps = 43/130 33%
Query  59   LTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQ-- 116
            ++ +E +  ++ HN  R+ V          G +P       L WN  LA+ AQ +A++  
Sbjct  25   ISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYADKRV 67
Query  117  --CDFNHDDCRNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNF 174
              C   H   R       G  +  S   AT++         W  E   ++ K    N   
Sbjct  68   GDCAMEHSMGRWGENLASGDGM--SGAAATKY---------WVTEKEFYDEK---SNKCV 113
Query  175  R-KVGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIYER 226
            + + GHY  +VWGKT E+GCG  K    N   +Y+VC+Y P      QP  ER
Sbjct  114  KDECGHYLAVVWGKTTEVGCGISKC---NNGQNYVVCSYDP----MYQPEDER 159

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.