The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF
TDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTF
EHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILM
KVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35778 Sol i 3 234 1624 376.9 3.1e-106
P35779 Sol r 3 211 1413 328.9 8e-92
C0ITL3 Pac c 3.0101 199 817 193.0 5.9e-51
P10737 Dol m 5.02 215 747 177.0 4.1e-46
AAA28302 Dol m 5.02 212 739 175.2 1.4e-45
P35781 Vesp c 5 202 704 167.3 3.4e-43
P35782 Vesp c 5 202 698 165.9 8.8e-43
P10736 Dol m 5.0101 227 696 165.4 1.4e-42
P81657 Vesp m 5 202 693 164.8 1.9e-42
Q05108 Dol a 5 203 693 164.8 1.9e-42
Q05110 Ves v 5 227 692 164.5 2.6e-42
P0DMB9 Vesp v 5.0101 202 689 163.9 3.6e-42
P35784 Ves g 5 204 687 163.4 5e-42
P35760 Ves m 5 204 686 163.2 5.9e-42
P35787 Ves vi 5 206 685 162.9 7e-42
P35783 Ves f 5 204 674 160.4 3.9e-41
P35785 Ves p 5 204 671 159.8 6.3e-41
C0HJV9 Poly p 5.0101 206 665 158.4 1.7e-40
P86686 Poly p 5.0102 207 664 158.1 1.9e-40
Q7Z156 Poly s 5.0101 207 661 157.5 3.1e-40
P35786 Ves s 5 205 658 156.8 5e-40
P81656 Pol d 5 206 647 154.3 2.8e-39
P83377 Pol g 5 206 640 152.7 8.6e-39
ABC58726 Sol s 3.0101 90 624 150.0 2.5e-38
P35780 Pol f 5 205 627 149.7 6.6e-38
Q05109 Pol a 5 209 622 148.6 1.5e-37
AAT95009 Pol e 5.0101 226 618 147.6 3.1e-37
P35759 Pol e 5.0101 205 606 144.9 1.8e-36
AAY32926 Sol g 3.0101 70 477 117.3 1.3e-28
AAF65314 Cte f 2 264 389 95.4 2e-21
QEA69430 Sco m 5.0101 210 359 88.6 1.7e-19
AAF82096 Glo m 5 259 308 76.9 7e-16
AVD29827 Art si 2.0101 163 197 51.8 1.5e-08
AVD29826 Art la 2.0101 163 197 51.8 1.5e-08
A0A2L1DGQ3 Art ar 2.0101 163 197 51.8 1.5e-08
AVD29822 Art an 2.0101 163 197 51.8 1.5e-08
AVD29824 Art ca 2.0101 163 197 51.8 1.5e-08
AVD29825 Art gm 2.0101 163 197 51.8 1.5e-08
ADM18345 Tab y 5.0101 256 176 46.8 7.9e-07
AAU15051 Cyn d 24.0101 153 142 39.4 8.3e-05
XP_007199020 Pru p 9.0101 161 129 36.4 0.0007
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 376.9 bits 1624,  Expect = 3e-106
 Identities = 234/234 100%, Positives = 234/234 100%, Gaps = 0/234 0%
Query  1    MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF 60
            MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF
Sbjct  1    MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF 60
Query  61   TDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTF 120
            TDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTF
Sbjct  61   TDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTF 120
Query  121  EHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILM 180
            EHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILM
Sbjct  121  EHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILM 180
Query  181  KVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK 234
            KVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK
Sbjct  181  KVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK 234

Sequence Alignment: 2. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 328.9 bits 1413,  Expect = 8e-92
 Identities = 203/211 96%, Positives = 205/211 97%, Gaps = 1/211 0%
Query  23   TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG 82
            TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG
Sbjct  1    TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG 60
Query  83   KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS 142
            KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS
Sbjct  61   KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS 120
Query  143  SGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIM 202
            SGKNKST ++MILLWYNEVKDFDNRWISSFPSD NILM VGHYTQIVWAKT KIGCGRIM
Sbjct  121  SGKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIM 180
Query  203  FKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK 234
            FKE DNW KHYLVCNYGPAGNVLGA IYEIKK
Sbjct  181  FKE-DNWNKHYLVCNYGPAGNVLGAQIYEIKK 211

Sequence Alignment: 3. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 193.0 bits 817,  Expect = 6e-51
 Identities = 112/195 57%, Positives = 139/195 71%, Gaps = 1/195 0%
Query  36   AIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPA 95
            A+HTMCQYTSP P P C  YSN   T A+K+ I+  HN+ RQ+V +G+E RG  GPQP A
Sbjct  5    AVHTMCQYTSPQPSPNCGTYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQPAA 64
Query  96   VKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMIL 155
              MP+LTWD ELA IAQRW NQC   HD CRNVER+ VGQNIA + S+ K     N ++ 
Sbjct  65   SNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNNLVQ 124
Query  156  LWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLV 215
            +W NEV  ++   +SS PSD N +MK+GHYTQ+VW KTTK+GCG I F +   + K YL 
Sbjct  125  MWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLD-GKFYKCYLA 183
Query  216  CNYGPAGNVLGAPIYE 231
            CNYGPAGN++GAPIY+
Sbjct  184  CNYGPAGNMFGAPIYQ 199

Sequence Alignment: 4. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 177.0 bits 747,  Expect = 4e-46
 Identities = 111/210 52%, Positives = 149/210 70%, Gaps = 10/210 4%
Query  16   NLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMC-LEYSNV-GFTDAEKDAIVNKHN 73
            NL+   A NYC ++ C R   IHT+C++ +    P C  +   V G ++ EK+ IVN+HN
Sbjct  4    NLSFGEANNYCKIK-CSR--GIHTLCKFGTSMK-PNCGSKLVKVHGVSNDEKNEIVNRHN 59
Query  74   ELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAV 133
            ++RQ+VA G E RG  GPQPPA  M  L W+ ELA IAQ WANQC+F HD CRN E++ V
Sbjct  60   QFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQV 119
Query  134  GQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKT 193
            GQN+A  S++G + +T +++I +W NEVKDF+ +  +     DN + KVGHYTQ+VW KT
Sbjct  120  GQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTM---GDNNFSKVGHYTQMVWGKT 176
Query  194  TKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             +IGCG + + E +NW  HYLVCNYGPAGN +  PIYE K
Sbjct  177  KEIGCGSVKYIE-NNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 5. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 175.2 bits 739,  Expect = 1e-45
 Identities = 109/207 52%, Positives = 148/207 71%, Gaps = 10/207 4%
Query  16   NLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMC-LEYSNV-GFTDAEKDAIVNKHN 73
            NL+   A NYC ++ C R   IHT+C++ + +  P C  +   V G ++ EK+ IVN+HN
Sbjct  4    NLSFGEANNYCKIK-CSRG--IHTLCKFGT-SMKPNCGSKLVKVHGVSNDEKNEIVNRHN 59
Query  74   ELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAV 133
            ++RQ+VA G E RG  GPQPPA  M  L W+ ELA IAQ WANQC+F HD CRN E++ V
Sbjct  60   QFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQV 119
Query  134  GQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKT 193
            GQN+A  S++G + +T +++I +W NEVKDF+ +  +     DN + KVGHYTQ+VW KT
Sbjct  120  GQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTM---GDNNFSKVGHYTQMVWGKT 176
Query  194  TKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIY 230
             +IGCG + + E +NW  HYLVCNYGPAGN +  PIY
Sbjct  177  KEIGCGSVKYIE-NNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 6. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 167.3 bits 704,  Expect = 3e-43
 Identities = 106/199 53%, Positives = 138/199 69%, Gaps = 13/199 6%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVAS 81
            NYC ++ C+  + IHT+C+Y + T  P C +      G+T  E   I+ +HNE+RQ+VA 
Sbjct  2    NYCKIK-CR--SGIHTLCKYGTSTK-PNCGKNVVKASGLTKQENLEILKQHNEFRQKVAR 57
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
            G E RG  GPQPPA  M  L W+ ELA IAQ WANQC + HD CRN  +++VGQNIA  S
Sbjct  58   GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGS 117
Query  142  SSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRI 201
            ++  N  + + M+ +W +EVKD+       + S  N L KVGHYTQ+VWAKT +IGCG I
Sbjct  118  TTADNFGSVSNMVKMWEDEVKDYQ------YGSPKNKLNKVGHYTQMVWAKTKEIGCGSI 171
Query  202  MFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + E + W +HYLVCNYGPAGNV   PIYE K
Sbjct  172  KYIE-NGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 7. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 165.9 bits 698,  Expect = 9e-43
 Identities = 107/199 53%, Positives = 136/199 68%, Gaps = 13/199 6%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVAS 81
            NYC ++ C+  + IHT+C+Y + T  P C +      G+T  E   I+ +HNE+RQ+VA 
Sbjct  2    NYCKIK-CR--SGIHTLCKYGTSTK-PNCGKNVVKASGLTKQENLEILKQHNEFRQKVAR 57
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
            G E RG  GPQPPA  M  L W+ ELA IAQ WANQC + HD CRN  +++VGQNIA  S
Sbjct  58   GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGS 117
Query  142  SSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRI 201
            +S  N    + M+ +W +EVKD+       + S  N L KVGHYTQ+VWAKT +IGCG  
Sbjct  118  TSADNFVNVSNMVKMWEDEVKDYQ------YGSPKNKLNKVGHYTQMVWAKTKEIGCGSE 171
Query  202  MFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + E D W +HYLVCNYGPAGNV   PIYE K
Sbjct  172  DYIE-DGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 8. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 165.4 bits 696,  Expect = 1e-42
 Identities = 106/217 48%, Positives = 143/217 65%, Gaps = 11/217 5%
Query  8    LWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEK 65
            L L IT  NL+     NYC ++ C++   IHT+C++ + +  P C        G+T+ EK
Sbjct  9    LILIITIINLSFGETNNYCKIK-CRK--GIHTLCKFGT-SMKPNCGRNVVKAYGLTNDEK 64
Query  66   DAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDAC 125
            + I+ +HN++RQ VA G E RG  GPQPPA  M  L W+ ELA IAQ WANQC F HD C
Sbjct  65   NEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDC 124
Query  126  RNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHY 185
            RN  ++ VGQNIA +S++      P+++I  W +EV +F+ +        ++ + KVGHY
Sbjct  125  RNTAKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYK----VGLQNSNFRKVGHY 180
Query  186  TQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            TQ+VW KT +IGCG I + E DNW  HYLVCNYGP GN +  PIYE K
Sbjct  181  TQMVWGKTKEIGCGSIKYIE-DNWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 9. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 164.8 bits 693,  Expect = 2e-42
 Identities = 103/198 52%, Positives = 141/198 71%, Gaps = 15/198 7%
Query  24   NYCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVA 80
            NYC ++ C+  + IHT+C++   T P  G   ++ S  G+T AEK  I+ +HNE+RQ+VA
Sbjct  2    NYCKIK-CR--SGIHTLCKFGISTKPNCGKNVVKAS--GLTKAEKLEILKQHNEFRQKVA 56
Query  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAAT 140
             G E RG  GPQPPA  M  L W+ ELA IAQ WA QC + HD CRN  +++VGQNIA  
Sbjct  57   RGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYSVGQNIAEN 116
Query  141  SSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGR 200
             S+  + ++ + M+ +W +EVK++       + S  N L++VGHYTQ+VWAKT +IGCG 
Sbjct  117  GSTAASFASVSNMVQMWADEVKNYQ------YGSTKNKLIEVGHYTQMVWAKTKEIGCGS 170
Query  201  IMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            I + E + W +HYLVCNYGPAGN+   PIYE K
Sbjct  171  IKYIE-NGWHRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 10. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 164.8 bits 693,  Expect = 2e-42
 Identities = 104/198 52%, Positives = 135/198 68%, Gaps = 16/198 8%
Query  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG 82
            NYC +  C +    HT+C+Y TS  P        + G T+ EK+ IV +HNE+RQ+VA G
Sbjct  2    NYCKI--CPKGT--HTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQG 57
Query  83   KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS 142
             E RG  GPQPPA  M  L W+ ELA IAQ WANQC F HD CRN  ++ VGQN+A  S+
Sbjct  58   LETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKYPVGQNVAIAST 117
Query  143  SGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDD---NILMKVGHYTQIVWAKTTKIGCG 199
            +G +  T + +I +W +EVKD++       P  D   N + KVGHYTQ+VW KT +IGCG
Sbjct  118  TGNSYQTMSYLIKMWEDEVKDYN-------PHKDLMHNNFSKVGHYTQMVWGKTKEIGCG 170
Query  200  RIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + + E + W  HYLVCNYGPAGN +  P+YE K
Sbjct  171  SVKYIE-NKWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 11. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 164.5 bits 692,  Expect = 3e-42
 Identities = 97/219 44%, Positives = 142/219 64%, Gaps = 7/219 3%
Query  8    LWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDA 67
            L + +T  +L    A NYC ++ C +   +HT C+Y S  P        + G+T  EK  
Sbjct  9    LIIIVTIIDLPYGKANNYCKIK-CLKGG-VHTACKYGSLKPNCGNKVVVSYGLTKQEKQD 66
Query  68   IVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRN 127
            I+ +HN++RQ++A G E RG  GPQPPA  M NL W+ ELA +AQ WANQC + HD CR+
Sbjct  67   ILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRD 126
Query  128  VERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQ 187
            V ++ VGQN+A T S+      P +++ +W +EVKD++ +    F  +D  ++K GHYTQ
Sbjct  127  VAKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPK--KKFSGND--FLKTGHYTQ 182
Query  188  IVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            +VWA T ++GCG I + + + W KHYLVCNYGP+GN +   +Y+ K
Sbjct  183  MVWANTKEVGCGSIKYIQ-EKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 12. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 163.9 bits 689,  Expect = 4e-42
 Identities = 104/199 52%, Positives = 135/199 67%, Gaps = 13/199 6%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVAS 81
            NYC ++ C+  + IHT+C+Y + T  P C        G+T AEK  I+ +HNE+RQ+VA 
Sbjct  2    NYCKIK-CR--SGIHTLCKYGTSTK-PNCGRSVVKASGLTKAEKLEILKQHNEFRQKVAR 57
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
            G E RG  GPQPPA  M  L W+ ELA IAQ WA+QC + HD CRN  ++ VGQNIA  S
Sbjct  58   GLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLVGQNIAEQS 117
Query  142  SSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRI 201
            ++  +    + M+ +W +EVKD+       + S  N L  VGHYTQ+VWAKT +IGCG I
Sbjct  118  TTAASFEPVSNMVKMWSDEVKDYQ------YGSSKNKLNDVGHYTQMVWAKTKEIGCGNI 171
Query  202  MFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + E + W  HYLVCNYGPAGN+   PIYE K
Sbjct  172  KYIE-NGWHHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 13. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 163.4 bits 687,  Expect = 5e-42
 Identities = 97/203 47%, Positives = 134/203 66%, Gaps = 7/203 3%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 83
            NYC ++  K    +HT C+Y S  P     +    G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCKIKCLK--GGVHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  84   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 143
            E RG  GPQPPA  M NL W  ELA IAQ WANQC + HD CR+V ++ VGQN+A T S+
Sbjct  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYPVGQNVALTGST 119
Query  144  GKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMF 203
                  P +++ +W +EVKD++ +    F S++N L K+GHYTQ+VWA T ++GCG I +
Sbjct  120  AAKYDNPVKLVKMWEDEVKDYNPK--KKF-SENNFL-KIGHYTQMVWANTKEVGCGSIKY 175
Query  204  KEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + D W KHYLVCNYGP+GN     +Y+ K
Sbjct  176  IQ-DKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 14. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 163.2 bits 686,  Expect = 6e-42
 Identities = 97/203 47%, Positives = 137/203 67%, Gaps = 7/203 3%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 83
            NYC ++  K    +HT C+Y S  P     +  + G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCKIKCLK--GGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  84   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 143
            E RG  GPQPPA  M NL W  ELA IAQ WANQC + HD CR+V ++ VGQN+A T S+
Sbjct  60   ETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGST 119
Query  144  GKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMF 203
                + P +++ +W +EVKD++ +    F S++N L K+GHYTQ+VWA T ++GCG I +
Sbjct  120  AAVYNDPVKLVKMWEDEVKDYNPK--KKF-SENNFL-KIGHYTQMVWANTKEVGCGSIKY 175
Query  204  KEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + +NW KHYLVCNYGP+GN     +Y+ K
Sbjct  176  IQ-ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 15. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 162.9 bits 685,  Expect = 7e-42
 Identities = 101/200 50%, Positives = 136/200 68%, Gaps = 14/200 7%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 81
            NYC ++  K    +HT C+Y + T  P C  +     G+T+AEK  I+  HN++RQ+VA 
Sbjct  3    NYCKIKCLK--GGVHTACKYGTSTK-PNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++ E++ VGQNIA  S
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRS 119
Query  142  SSGKNKSTPNEMILLWYNEVKDFDN--RWISSFPSDDNILMKVGHYTQIVWAKTTKIGCG 199
            ++     +P +++ +W NEVKDF+    W     S +N L K GHYTQ+VWAKT +IGCG
Sbjct  120  TTAALFDSPGKLVKMWENEVKDFNPNIEW-----SKNN-LKKTGHYTQMVWAKTKEIGCG 173
Query  200  RIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + + + D W  HYLVCNYGP+GN     +YE K
Sbjct  174  SVKYVK-DEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 16. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 160.4 bits 674,  Expect = 4e-41
 Identities = 95/203 46%, Positives = 133/203 65%, Gaps = 7/203 3%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 83
            NYC ++  K    +HT C+Y S  P        + G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCKIKCLK--GGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGL 59
Query  84   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 143
            E RG  GPQPPA  M NL W+ ELA +AQ WANQC + HD CR++ ++ VGQN+A T S+
Sbjct  60   ETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQVGQNVALTGST 119
Query  144  GKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMF 203
                  P +++ +W +EVKD++ +    F S +N L K GHYTQ+VWA T ++GCG I F
Sbjct  120  AAKYDDPVKLVKMWEDEVKDYNPK--KKF-SGNNFL-KTGHYTQMVWANTKEVGCGSIKF 175
Query  204  KEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + + W KHYLVCNYGP+GN     +Y+ K
Sbjct  176  IQ-EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 17. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 159.8 bits 671,  Expect = 6e-41
 Identities = 95/203 46%, Positives = 135/203 66%, Gaps = 7/203 3%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASGK 83
            NYC ++  K    +HT C+Y S  P        + G+T  EK  I+ +HN++RQ++A G 
Sbjct  2    NYCKIKCLK--GGVHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGL 59
Query  84   EMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSS 143
            E RG  GPQPPA  M NL W+ ELA +AQ WANQC + HD CR+V ++ VGQN+A T S+
Sbjct  60   ETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYPVGQNVALTGST 119
Query  144  GKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMF 203
                  P +++ +W +EVKD++ +    F S++N + K+GHYTQ+VWA T +IGCG I +
Sbjct  120  ADKYDNPVKLVKMWEDEVKDYNPK--KKF-SENN-FNKIGHYTQMVWANTKEIGCGSIKY 175
Query  204  KEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + + W KHYLVCNYGP+GN     +Y+ K
Sbjct  176  IQ-NEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 18. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 158.4 bits 665,  Expect = 2e-40
 Identities = 107/200 53%, Positives = 137/200 68%, Gaps = 13/200 6%
Query  25   YCNLQSCKRNNAIHTMCQY-TSPTPGPMCLEYS--NVGFTDAEKDAIVNKHNELRQRVAS 81
            YCN++ C +    HT+CQY  S  P   C + S  +VG T+ EK  IV++HN +RQ+VA 
Sbjct  3    YCNIK-CSK--VAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 59
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAAT 140
            G E RG  GPQP A  M NL W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA +
Sbjct  60   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS 119
Query  141  SSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGR 200
            +S+       + +I+LW NEVKDF+    S   + +N + KVGHYTQ+VWAKT ++GCG 
Sbjct  120  ASTAAYPGIVS-LIVLWENEVKDFN---YSQGITKEN-FSKVGHYTQVVWAKTKEVGCGS 174
Query  201  IMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            I + E      HYLVCNYGPAGN +G PIY  K
Sbjct  175  IKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 19. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 158.1 bits 664,  Expect = 2e-40
 Identities = 111/198 56%, Positives = 141/198 71%, Gaps = 18/198 9%
Query  25   YCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYS--NVGFTDAEKDAIVNKHNELRQRV 79
            YCN++ C +    HT+CQ    T P+    C + S  +VG T+ EK  IV++HN +RQ+V
Sbjct  3    YCNIK-CSK--VAHTVCQTGESTKPS-SKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKV 58
Query  80   ASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIA 138
            A G E RG  GPQP A  M NL W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA
Sbjct  59   AQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIA 118
Query  139  ATSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIG 197
             ++S+        ++I+LW NEVKDF+ N  I+     +N + KVGHYTQ+VWAKT ++G
Sbjct  119  YSASTAAYPGVV-KLIVLWENEVKDFNYNTGITK----EN-FAKVGHYTQVVWAKTKEVG 172
Query  198  CGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            CG I + E      HYLVCNYGPAGNVLGA IYEIK
Sbjct  173  CGSIKYIEK-GMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 20. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 157.5 bits 661,  Expect = 3e-40
 Identities = 108/199 54%, Positives = 138/199 69%, Gaps = 16/199 8%
Query  25   YCNLQSCKRNNAIHTMCQY---TSPTPGPMCLEYS--NVGFTDAEKDAIVNKHNELRQRV 79
            YCN++ C +    HT+CQY   T P+    C + S  +VG T+ EK  IV++HN +RQ+V
Sbjct  3    YCNIK-CSK--VAHTVCQYGESTKPS-SKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKV 58
Query  80   ASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIA 138
            A G E RG  GPQP A  M NL W+ ELA IAQ WANQC F  HD CRN  ++ VGQNIA
Sbjct  59   AQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIA 118
Query  139  ATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
             ++S+       + +I+LW NEVKDF+    S   + +N + KVGHYTQ+VWAKT ++GC
Sbjct  119  YSASTAAYPGIVS-LIVLWENEVKDFN---YSQGITKEN-FAKVGHYTQVVWAKTKEVGC 173
Query  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            G I + E      HYLVCNYGPAGN +G PIY  K
Sbjct  174  GSIKYIEK-GMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 21. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 156.8 bits 658,  Expect = 5e-40
 Identities = 97/202 48%, Positives = 131/202 64%, Gaps = 10/202 4%
Query  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 81
            +YC ++  K    +HT C+Y + T  P C  +   + G T AEK  I+  HN++R +VA 
Sbjct  2    DYCKIKCLK--GGVHTACKYGTSTK-PNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++  ++ VGQNIA +S
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSS 118
Query  142  SSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRI 201
            S+         ++  W NEVKDF+     +   + N + K+GHYTQ+VWAKT +IGCG I
Sbjct  119  STAAVYENVGNLVKAWENEVKDFN----PTISWEQNEFKKIGHYTQMVWAKTKEIGCGSI 174
Query  202  MFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
             + + +NW  HYLVCNYGPAGN     +YE K
Sbjct  175  KYVD-NNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 22. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 154.3 bits 647,  Expect = 3e-39
 Identities = 105/200 52%, Positives = 134/200 67%, Gaps = 15/200 7%
Query  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
            +YC ++ C  ++ +HT+CQY  S  P   C      +VG T+ EK  IV +HN +RQ+VA
Sbjct  2    DYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVA 58
Query  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 139
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN E++ VGQNIA 
Sbjct  59   KGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAY 118
Query  140  TSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
              SS    S   ++I LW NEVKDF+ N  I+     +  + KVGHYTQ+VW  T ++GC
Sbjct  119  AGSSNHFPSV-TKLIQLWENEVKDFNYNTGIT-----NKNFGKVGHYTQMVWGNTKEVGC 172
Query  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            G + + E  N   HYL+CNYGPAGN LG PIY  K
Sbjct  173  GSLKYVEK-NMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 23. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 152.7 bits 640,  Expect = 9e-39
 Identities = 104/200 52%, Positives = 133/200 66%, Gaps = 15/200 7%
Query  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
            +YC ++ C  ++ +HT+CQY  S  P   C      +VG T+ EK  IV +HN +RQ+VA
Sbjct  2    DYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVA 58
Query  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 139
             G E RG  GPQP A  M NL W+ E A IAQ WA+QC  + HD CRN E++ VGQNIA 
Sbjct  59   QGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAY 118
Query  140  TSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
              SS    S   ++I LW NEVKDF+ N  I+     +  + KVGHYTQ+VW  T ++GC
Sbjct  119  AGSSNHFPSV-TKLIQLWENEVKDFNYNTGIT-----NKNFGKVGHYTQMVWGNTKEVGC 172
Query  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            G + + E  N   HYL+CNYGPAGN LG PIY  K
Sbjct  173  GSLKYVEK-NMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 24. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 150.0 bits 624,  Expect = 2e-38
 Identities = 89/90 98%, Positives = 89/90 98%, Gaps = 0/90 0%
Query  23   TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG 82
            TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG
Sbjct  1    TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG 60
Query  83   KEMRGTNGPQPPAVKMPNLTWDPELATIAQ 112
            KEMRGTN PQPPAVKMPNLTWDPELATIAQ
Sbjct  61   KEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 25. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 149.7 bits 627,  Expect = 7e-38
 Identities = 104/199 52%, Positives = 135/199 67%, Gaps = 16/199 8%
Query  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
            +YC ++ C  ++ IHT+CQY  S  P   C +    +VG T+ EK  IVN+HN +RQ+VA
Sbjct  2    DYCKIK-C--SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVA 58
Query  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 139
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN  ++ VGQNIA 
Sbjct  59   QGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY 118
Query  140  TSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
              + G        +I LW NEVKDF+ N+ I+      N + KVGHYTQ++WAKT +IGC
Sbjct  119  --AGGSKLPDVVSLIKLWENEVKDFNYNKGITK----QN-FGKVGHYTQMIWAKTKEIGC 171
Query  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            G + + + +N   HYL+CNYGPAGN LG   Y  K
Sbjct  172  GSLKYMK-NNMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 26. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 148.6 bits 622,  Expect = 2e-37
 Identities = 102/205 49%, Positives = 134/205 65%, Gaps = 14/205 6%
Query  19   NTLATNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNEL 75
            ++   +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +
Sbjct  1    SSQGVDYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRF 57
Query  76   RQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVG 134
            RQ+VA G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VG
Sbjct  58   RQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVG 117
Query  135  QNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTT 194
            QNIA   + G N      +I LW NEVKDF+    ++  +  N + K+GHYTQ+VW KT 
Sbjct  118  QNIAY--AGGSNLPDVVSLIKLWENEVKDFN---YNTGITKQN-FAKIGHYTQMVWGKTK 171
Query  195  KIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            +IGCG + + E +N   HYL+CNYGPAGN LG   Y  K
Sbjct  172  EIGCGSLKYME-NNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 27. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 147.6 bits 618,  Expect = 3e-37
 Identities = 103/215 47%, Positives = 139/215 64%, Gaps = 15/215 6%
Query  1    MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSN 57
            ME I  +++L I    + ++   +YC ++ C   + IHT+CQY  S  P   C      +
Sbjct  1    ME-IGGLVYLVIVVAIIHSSQGVDYCKIR-CP--SGIHTVCQYGESTKPSKNCAGKVIKS 56
Query  58   VGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQ 117
            VG T+ EK  IV++HN +RQ+VA G E RG  GPQP A  M +L W+ ELA IAQ WA+Q
Sbjct  57   VGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQ 116
Query  118  CTFE-HDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDD 176
            C F  HD CRN  ++ VGQNIA   + G        +I LW NEVKDF+    ++  +  
Sbjct  117  CQFLVHDKCRNTAKYPVGQNIAY--AGGSKLPDVVSLIKLWENEVKDFN---YNTGITKQ 171
Query  177  NILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLG 226
            N + K+GHYTQ+VW KT +IGCG + + E +    HYL+CNYGPAGN LG
Sbjct  172  N-FAKIGHYTQMVWGKTKEIGCGSLKYME-NKMQNHYLICNYGPAGNYLG 219

Sequence Alignment: 28. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 144.9 bits 606,  Expect = 2e-36
 Identities = 102/199 51%, Positives = 130/199 65%, Gaps = 16/199 8%
Query  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
            +YC ++ C   + IHT+CQY  S  P   C      +VG T+ EK  IV++HN +RQ+VA
Sbjct  2    DYCKIK-CP--SGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVA 58
Query  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE-HDACRNVERFAVGQNIAA 139
             G E RG  GPQP A  M +L W+ ELA IAQ WA+QC F  HD CRN  ++ VGQNIA 
Sbjct  59   QGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAY 118
Query  140  TSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
              + G        +I LW NEVKDF+ N  I+      N + K+GHYTQ+VW KT +IGC
Sbjct  119  --AGGSKLPDVVSLIKLWENEVKDFNYNTGITK----QN-FAKIGHYTQMVWGKTKEIGC 171
Query  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233
            G + + E +    HYL+CNYGPAGN LG   Y  K
Sbjct  172  GSLKYIE-NKMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 29. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 117.3 bits 477,  Expect = 1e-28
 Identities = 66/70 94%, Positives = 67/70 95%, Gaps = 0/70 0%
Query  165  DNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 224
            DNRWISSFPSD NILMK+GHYTQIVWAKT KIGCGRIMFKEPDNWTKHYLVCNYGPAGNV
Sbjct  1    DNRWISSFPSDPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV 60
Query  225  LGAPIYEIKK 234
            LGA IYEIKK
Sbjct  61   LGAKIYEIKK 70

Sequence Alignment: 30. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 95.4 bits 389,  Expect = 2e-21
 Identities = 79/224 35%, Positives = 114/224 50%, Gaps = 15/224 6%
Query  3    LIVSILWLAIT-AENLA-NTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF 60
            ++V  +WL++  A N+       +YCNL +C   N  +  C  T P     C  +  V  
Sbjct  10   IVVFSVWLSVIFAVNVKPKPNQDDYCNL-NC--TNGPNVGC--TKPDVPRDCQNFKLVNI 64
Query  61   TDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTF 120
            T+  K A +N HN  R+ VA+GK +       P A KMPNLTW+  LA +A+    QC  
Sbjct  65   TERMKKAFLNAHNRKRRLVAAGKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCEM 124
Query  121  EHDACRNVERFAVGQNI---AATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDN 177
            +HD C        GQN+     T S  KN +     +  WY E KD     I  + +   
Sbjct  125  KHD-CAKTRHGHTGQNLFFYGTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYP 183
Query  178  ILMKVGHYTQIVWAKTTKIGCGRIMFKEPDN---WTKHYLVCNYGPAGNVLGAPIYEIK 233
                +GHYTQ++W  TTK+GC    +K+  N   +    + CNY   GN+L   +Y+IK
Sbjct  184  NGKPIGHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 31. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 88.6 bits 359,  Expect = 2e-19
 Identities = 65/157 41%, Positives = 94/157 59%, Gaps = 19/157 12%
Query  59   GFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQC 118
            G+    K  I++ HN+ RQ VA+G++    +G QP A  M  L WD ++A  AQR A  C
Sbjct  30   GLDANMKKMILDLHNKKRQTVANGQQ----SG-QPSAANMKELHWDDQIAANAQRSAETC 84
Query  119  TFEHDA--CRNVERFA-VGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSD 175
             F+H A   R   +++ +G+NI   S       + N     WY+EVKD     + SF S 
Sbjct  85   VFQHTAKNLRKTSKYSYLGENIYMGSYPDPIPRSVNA----WYDEVKDVTPAVVKSFRSG 140
Query  176  DNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYE 231
              +   +GHYTQ+VWA T  +GCG +   + +     Y+ C YGP+GN  G PIY+
Sbjct  141  GPM---IGHYTQMVWANTEALGCGLVTASDKNT----YIFCQYGPSGNYPGEPIYK 189

Sequence Alignment: 32. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 76.9 bits 308,  Expect = 7e-16
 Identities = 67/212 31%, Positives = 108/212 50%, Gaps = 26/212 12%
Query  1    MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGF 60
            M ++++ L L I     +  +  +YC L  C  ++A      + S  P       S    
Sbjct  1    MNFVLATLSLLILG---SAAVGGDYCGL--CDNHDACVMQNVFQSGCP-------SGAKM 48
Query  61   TDAEK--DAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQC 118
             D  K   A+++ HN+ R  VA G E +        A +M  + WD ELA +A+    QC
Sbjct  49   IDLNKYQSALLDAHNKKRNHVAGGGESK-----LKRACQMATMKWDSELAKLAEYNVKQC 103
Query  119  TFEHDACRNVERFA-VGQNIAATSSSG----KNKSTPNEMILLWYNEVKDFDNRWISSFP 173
               HD CRN  +F   GQN+A    SG      +    + +  WY EVKD +  +I S+P
Sbjct  104  QMNHDRCRNTVKFKYAGQNLAELGRSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYP 163
Query  174  SDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYE 231
             +      +GH+T +V  + T +GC    + + + +    + CNY    N++  PIY+
Sbjct  164  MNYRG-PAIGHFTVMVAERNTHVGCAASEYTKSNGFQYFLMACNYATT-NMMEFPIYK 219

Sequence Alignment: 33. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 49/113 43%, Positives = 71/113 62%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  V     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAEARTAD---CSLVHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 34. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 48/113 42%, Positives = 71/113 62%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  +     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPD---CSLIHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 48/113 42%, Positives = 71/113 62%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  +     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPD---CSLIHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 50/113 44%, Positives = 70/113 61%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  V     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPD---CSLVHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA T ++GCGR +    + W  +  VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANTERVGCGRALCS--NGWA-YITVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 48/113 42%, Positives = 71/113 62%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  +     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPD---CSLIHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 50/113 44%, Positives = 70/113 61%, Gaps = 21/113 18%
Query  98   MPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLW 157
            M  L WD ELA +AQ WA   T +   C  V     G+N+A  + +G      +  + LW
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPD---CSLVHSDRCGENMAQGAING------SMAVQLW 100
Query  158  YNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVC 216
             +E  D+D         ++N  +K+ GHYTQIVWA T ++GCGR +    + W  +  VC
Sbjct  101  LDERLDYDY--------NENKCIKMCGHYTQIVWANTERVGCGRALCS--NGWA-YITVC 149
Query  217  NYGPAGNVLGAPIY 230
            NY P GNV+G   Y
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 46.8 bits 176,  Expect = 8e-07
 Identities = 59/209 28%, Positives = 97/209 46%, Gaps = 31/209 14%
Query  3    LIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNV-GFT 61
            +IV  L L +     +   + +YC+L  C+     H  C   SP     C + +    FT
Sbjct  4    IIVPCLLLVVLVLQCSVINSLDYCSL--CRGGRGEHVGCG--SPGFSSDCGQKARTRKFT 59
Query  62   DAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFE 121
               K  I++K N++R  VA     +G+ G  P A +M  + WD ELA +A+R    C  E
Sbjct  60   KEHKKVILDKINDVRDHVA-----KGSWG-LPVASRMKVIVWDEELAALAKRHTQGCVPE 113
Query  122  HDACRNVERFAVGQNIAATSSSGKNKSTPNEMILL----------WYNEVKDFDNRWISS 171
               CR+  RF     +     + K    P+ M L+           +N  +D   ++  +
Sbjct  114  AYKCRHTLRFWSPGQLNFEFYADK---MPSTMSLISTAIKRGHTQKHNITRDIIEKYQPA 170
Query  172  FPSDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYE 231
             P  +     V      +  + T +GCG   +K      +  L CN+    N    P+Y+
Sbjct  171  GPKGN-----VKELALAISDRVTAVGCGLTTWKLGGK-ARALLTCNFSSE-NDYNRPVYK 223

Sequence Alignment: 40. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 39.4 bits 142,  Expect = 8e-05
 Identities = 48/134 35%, Positives = 77/134 57%, Gaps = 32/134 23%
Query  59   GFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQC 118
            G+ D     I+N+HN +R      KE             +P LTW+  LA  +Q +A + 
Sbjct  12   GLNDKAIQDILNEHNMFR-----AKE------------HVPPLTWNTTLAKFSQDYA-ES 53
Query  119  TFEHDACRNVERFA-VGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDN 177
             ++ D C+ V   +  G+N+   S +   K+T    +  W +E K +      S   D  
Sbjct  54   KLKKD-CKMVHSDSPYGENLMFGSGAISWKTT----VDTWSDEKKSYH---YGSNTCDQG 105
Query  178  ILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 223
             +   GHYT +VW  TT +GCGR++    D+     ++C+Y P GN
Sbjct  106  KM--CGHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGN 146

Sequence Alignment: 41. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 36.4 bits 129,  Expect = 0.0007
 Identities = 44/126 34%, Positives = 75/126 59%, Gaps = 42/126 33%
Query  57   NVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWAN 116
            +   +  E D  V +HN+ R+ V          G +P       L W+  LA  AQ +A+
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  117  Q----CTFEHDACRNVERFAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSF 172
            +    C  EH   R  E +A G  ++  +++             W  E + +D +     
Sbjct  65   KRVGDCAMEHSMGRWGENLASGDGMSGAAATK-----------YWVTEKEFYDEK----- 108
Query  173  PSDDNILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGP 220
             S+  +  + GHY  +VW KTT++GCG     + +N  ++Y+VC+Y P
Sbjct  109  -SNKCVKDECGHYLAVVWGKTTEVGCG---ISKCNN-GQNYVVCSYDP 151

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.