The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA
AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB42069 Lyc e 3 114 796 155.9 2.5e-40
P93224 Sola l 3.0101 114 796 155.9 2.5e-40
A0AT29 Len c 3.0101 118 461 94.0 1.1e-21
ABX56711 Ara h 9.0101 116 438 89.7 2.1e-20
AAL25839 Hev b 12 116 436 89.3 2.8e-20
Q9M5X8 Pru av 3 117 426 87.5 1e-19
ABY21307 Pla or 3.0101 118 426 87.5 1e-19
CAL07989 Pla a 3.0101 118 422 86.7 1.7e-19
ACV04796 Api g 2 118 421 86.6 1.9e-19
A0A161AT60 Pis s 3.0101 120 421 86.6 2e-19
W0U0V5 Can s 3.0101 91 413 85.0 4.2e-19
A0A059SSZ0 Pun g 1.0201 120 414 85.3 4.8e-19
ADC80502 Pha v 3.0101 115 413 85.1 5.2e-19
XP_019446786 Lup an 3.0101 116 411 84.7 6.8e-19
ABX75045 Ara h 9.0201 92 404 83.4 1.4e-18
Q9M5X7 Mal d 3 115 405 83.6 1.5e-18
Q8VX12 Fra a 3.0101 117 398 82.3 3.6e-18
Q4PLT6 Fra a 3.0202 117 397 82.1 4.1e-18
Q0Z8V0 Rub i 3.0101 117 396 81.9 4.7e-18
ADC80503 Pha v 3.0201 118 396 81.9 4.7e-18
A0A059ST23 Pun g 1.0301 120 396 81.9 4.8e-18
AAK28533 Cor a 8 115 394 81.6 6e-18
A0A059STC4 Pun g 1.0101 120 393 81.4 7.1e-18
P85894 Mor n 3.0101 91 388 80.4 1e-17
Q4PLT9 Fra a 3.0102 117 387 80.3 1.5e-17
Q4PLU0 Fra a 3.0201 117 386 80.1 1.7e-17
Q9M5X6 Pyr c 3 115 384 79.7 2.2e-17
ANC85026 Art si 3.0101 116 381 79.2 3.2e-17
ACN11576 Pru du 3.0101 123 381 79.2 3.4e-17
ANC85020 Art ar 3.0102 116 380 79.0 3.6e-17
ANC85027 Art si 3.0102 116 380 79.0 3.6e-17
ACE07187 Art v 3.0202 116 380 79.0 3.6e-17
P19656-1 Zea m 14.0101 120 376 78.2 6.2e-17
P19656-2 Zea m 14.0102 128 372 77.5 1.1e-16
ANC85023 Art gm 3.0102 117 371 77.3 1.2e-16
EU564845 Art v 3.0201 114 370 77.1 1.3e-16
ANC85024 Art la 3.0101 116 370 77.1 1.3e-16
ANC85019 Art ar 3.0101 116 370 77.1 1.3e-16
QIN55516 Art ca 3.0102 117 370 77.1 1.3e-16
ANC85022 Art gm 3.0101 117 368 76.8 1.7e-16
ANC85018 Art an 3.0102 117 360 75.3 4.7e-16
EU564847 Art v 3.0301 117 359 75.1 5.4e-16
ANC85025 Art la 3.0102 115 357 74.7 6.8e-16
ANC85017 Art an 3.0101 117 355 74.4 9e-16
ANC85021 Art ca 3.0101 117 355 74.4 9e-16
P81651 Pru ar 3 91 353 73.9 9.3e-16
CAB96876 Pru p 3 91 350 73.4 1.4e-15
P81402 Pru p 3 91 350 73.4 1.4e-15
P82534 Pru d 3 91 347 72.8 2e-15
CAH69206 Tri tu 14.0101 115 339 71.4 6.9e-15
AAA32970 Hor v 1 117 335 70.7 1.2e-14
ABU95411 Sin a 3.0101 92 332 70.1 1.4e-14
CAA42832 Hor v 1 134 332 70.1 1.9e-14
A0A510A9S3 Ara h 17.0101 93 321 68.0 5.7e-14
P82007 Hel a 3.0101 116 316 67.1 1.3e-13
19846220 Tri a 14.0101 90 301 64.3 7.2e-13
NP_001316123 Sola l 7.0101 115 296 63.4 1.7e-12
Q40905 Par j 1 138 236 52.4 4.4e-09
O04404 Par j 1 176 233 51.9 8e-09
P43217 Par j 1 139 228 50.9 1.2e-08
CAI94601 Par j 1.0103 139 224 50.2 2e-08
O04403 Par j 2 133 216 48.7 5.5e-08
P55958 Par j 2 133 211 47.8 1e-07
CAA54587 Par j 1.0101 133 206 46.8 2e-07
O04004 Amb a 6 118 196 45.0 6.4e-07
P0C088 Art v 3.0101 37 121 30.9 0.0034
10998016 Cas s 8 36 120 30.7 0.0037
P80274 Vit v 1 37 115 29.8 0.0072
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 155.9 bits 796,  Expect = 3e-40
 Identities = 114/114 100%, Positives = 114/114 100%, Gaps = 0/114 0%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60
            MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA
Sbjct  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60
Query  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ
Sbjct  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 2. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 155.9 bits 796,  Expect = 3e-40
 Identities = 114/114 100%, Positives = 114/114 100%, Gaps = 0/114 0%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60
            MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA
Sbjct  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA 60
Query  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ
Sbjct  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 3. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 94.0 bits 461,  Expect = 1e-21
 Identities = 71/109 65%, Positives = 83/109 76%, Gaps = 3/109 2%
Query  6    KIACFV-VFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAK 62
            K+AC V V CMVV+AP AE ++SCG VTS L+PCL YL G  GP   CCGGVK LL AA 
Sbjct  6    KLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAAN 65
Query  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            T  DR+ AC CLKSAA SI  ++T  AA LPG CGVNIPYKIS +T+C+TV+
Sbjct  66   TTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 4. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 89.7 bits 438,  Expect = 2e-20
 Identities = 60/109 55%, Positives = 82/109 75%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVV-APHAESLSCGEVTSGLAPCLPYL-EGRGPLGGCCGGVKGLLGAAKT 63
            K A  ++ CM +V AP   ++SCG+V S LAPC+P+L +G  P   CC GV+GLLGA +T
Sbjct  5    KFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRT 64
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+ AC CLK+AA S++G++ G AA LPG CGV+IPYKIS ST+C+T++
Sbjct  65   TADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 5. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 89.3 bits 436,  Expect = 3e-20
 Identities = 63/109 57%, Positives = 82/109 75%, Gaps = 3/109 2%
Query  6    KIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL--GGCCGGVKGLLGAAK 62
            K+  F+V+CM+V AP  A++++CG+V S L PCL YL+  GP     CC GV+ +  AAK
Sbjct  5    KMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAK 64
Query  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            T  DR+TAC CLKSAA S+KG++    AGLPG CGVNIPYKIS ST+C+TV+
Sbjct  65   TTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 6. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 87.5 bits 426,  Expect = 1e-19
 Identities = 57/109 52%, Positives = 79/109 72%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTP 64
            K+A  V +CMVV  P A++L+CG+V+S LAPC+ Y+ G G +   CC G++ +   AKT 
Sbjct  8    KLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+TAC CLK  + S+ G++   AA LPG CGVN+PYKISPST+C+TV+
Sbjct  68   ADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 7. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 87.5 bits 426,  Expect = 1e-19
 Identities = 61/109 55%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
            K+AC+++ CMV  APHAE+ ++CG V + L PCL YL   G +   CC GVK L   AKT
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKT 67
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+ AC CLK+A+ SI GI  G AA L G CGVN+PYKISP+ DCS V+
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 8. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 86.7 bits 422,  Expect = 2e-19
 Identities = 60/109 55%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
            K+AC+++ CMV  APHAE+ ++CG V + L PCL +L   G +   CC GVK L   AKT
Sbjct  8    KLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKT 67
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+ AC CLK+A+ SI GI  G AA L G CGVN+PYKISP+ DCS V+
Sbjct  68   TPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 9. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 86.6 bits 421,  Expect = 2e-19
 Identities = 67/108 62%, Positives = 76/108 70%, Gaps = 5/108 4%
Query  6    KIACFV-VFCMVVVAPH---AESLSCGEVTSGLAPCLPYLEGRG-PLGGCCGGVKGLLGA 60
            K+A  V V  MVVV  H    E L+CG+VT  L  CL YL+G G P   CCGGVKGL   
Sbjct  5    KVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSL 64
Query  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
            AKTP DRK AC CLK+ A S+KGI+ G A+ LPG CG+ IPY ISPSTDCS V
Sbjct  65   AKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 10. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 86.6 bits 421,  Expect = 2e-19
 Identities = 65/109 59%, Positives = 81/109 74%, Gaps = 5/109 4%
Query  6    KIACF-VVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEG---RGPLGGCCGGVKGLLGA 60
            K+AC  +V CMVV+AP AE+ LSCG V++ +APC+ YL+      P   CC GVK LL A
Sbjct  6    KLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAA 65
Query  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            A T  DR+ AC CLKSAA SI  ++T  AA LPG CGV+IPYKIS ST+C+TV+
Sbjct  66   ATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 11. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 85.0 bits 413,  Expect = 4e-19
 Identities = 58/90 64%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V S LAPCL YL+  G +  GCC  +K L GAAKTP DR+ AC CLKSAA+SIKG
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   A+GLPG CGV+IPYKISPSTDCS+V+
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 12. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 85.3 bits 414,  Expect = 5e-19
 Identities = 61/102 59%, Positives = 72/102 70%, Gaps = 3/102 2%
Query  13   FCMVVVAPHAES-LSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKT 69
            +CMVV A   ES ++CG+VTS L PC+PY  G    P   CC GV+ L  AAKT  DR+T
Sbjct  16   LCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQT 75
Query  70   ACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AC CLK  A SI GI+ G+   LPG CGV+IPYKISPSTDCS V+
Sbjct  76   ACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 13. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 85.1 bits 413,  Expect = 5e-19
 Identities = 53/108 49%, Positives = 79/108 73%, Gaps = 2/108 1%
Query  6    KIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
            K AC VV+CMVVV  H A+ ++CG+V S L PC+ +L+  G +  GCC GV+ ++ +A++
Sbjct  5    KFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARS 64
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
              DR+  C CLK+AA +++G++   A  LPG CGVNIPYKIS ST+C+++
Sbjct  65   TADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 14. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 84.7 bits 411,  Expect = 7e-19
 Identities = 58/109 53%, Positives = 79/109 72%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVV-APHAESLSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLLGAAKT 63
            K+AC V+ CMVVV AP  ++++CG+VT+ LA CL YL   G +   CC G+K +L  AKT
Sbjct  6    KLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKT 65
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+TAC CLK+AA +  G++   A  LPG CGVNIPYKIS ST+C++++
Sbjct  66   TPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 15. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 83.4 bits 404,  Expect = 1e-18
 Identities = 56/90 62%, Positives = 70/90 77%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRG-PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            LSCG+V S LAPC+ +L   G P G CC GV+GLLGAAKT  DR+ AC CLK+AA S+ G
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++ G AA LPG CGV+IPYKIS ST+C+T++
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 16. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 83.6 bits 405,  Expect = 1e-18
 Identities = 57/107 53%, Positives = 77/107 71%, Gaps = 3/107 2%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTP 64
            K+A  V +CM V   HA  ++CG+VTS LAPC+ Y+   G +   CC G++ + G A+T 
Sbjct  8    KLALVVALCMAVSVAHA--ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTT 65
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+TAC CLK+ A SI G++   AAGLPG CGVN+PYKIS ST+C+TV+
Sbjct  66   ADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 17. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 82.3 bits 398,  Expect = 4e-18
 Identities = 52/109 47%, Positives = 78/109 71%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTP 64
            K++   ++C+VV  P A++++CG+V S ++PCL Y++  G +   CC G++ L G AKT 
Sbjct  8    KLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+ AC CLK AA  IKG++   AAGLPG CGV++PYKIS +T+C+ V+
Sbjct  68   ADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 18. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 82.1 bits 397,  Expect = 4e-18
 Identities = 52/109 47%, Positives = 79/109 72%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTP 64
            K++   ++C+VV  P A++++CG+V S ++PC+ Y++  G +   CC G++ L  AAKT 
Sbjct  8    KLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+T C CLK A+ +IKG++   AAGLPG CGVN+PYKIS ST+C+ V+
Sbjct  68   ADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 19. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 81.9 bits 396,  Expect = 5e-18
 Identities = 54/109 49%, Positives = 78/109 71%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTP 64
            K+A   ++C+VV  P A++++CG+VT  +APC+ Y++  G +   CC GV+ L   AKT 
Sbjct  8    KLALVALLCIVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+  C CLK+AA SI G++   AAGLPG CGV++PYKIS ST+C+TV+
Sbjct  68   ADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 20. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 81.9 bits 396,  Expect = 5e-18
 Identities = 60/107 56%, Positives = 78/107 72%, Gaps = 4/107 3%
Query  8    ACFV-VFCMVVV-APHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
            AC V V+C+VV+ AP A + +SCG+VTS LA C+P+L   GP+   CC GV+ L  AAKT
Sbjct  7    ACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKT 66
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+  C CLKSAA +I G +   A  LPG CGV+IPYKIS ST+C+T++
Sbjct  67   TPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 21. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 81.9 bits 396,  Expect = 5e-18
 Identities = 59/111 53%, Positives = 79/111 71%, Gaps = 4/111 3%
Query  4    FGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRG--PLG-GCCGGVKGLLG 59
            F ++A FV+ CM V +  AE+ ++CG+V+S LA C+ Y  G G  P+   CC G++ L  
Sbjct  6    FLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNS 65
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+ AC CLKS A+SI GI+ G  AG PG CGV+IPYKI+PST+C  V+
Sbjct  66   AAKTTPDRQAACRCLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 22. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 81.6 bits 394,  Expect = 6e-18
 Identities = 56/109 51%, Positives = 76/109 69%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVVAPHAE-SLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKT 63
            K+ C V++CM+V AP A  SL+C ++   L PC+ YL+  G L   CC GV+ +  A++T
Sbjct  5    KLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRT 64
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR++AC CLK  A  I G++   AAGLPG CGVNIPYKISPST+C+ V+
Sbjct  65   TSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 23. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 81.4 bits 393,  Expect = 7e-18
 Identities = 60/108 55%, Positives = 74/108 68%, Gaps = 6/108 5%
Query  6    KIACFVVFCMVVVAPHAE--SLSCGEVTSGLAPCLPYLEGRG---PLGGCCGGVKGLLGA 60
            K+AC V    +V AP A   +++CG+V S LAPC+PY    G   P   CC G+K L G 
Sbjct  8    KLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGGAVP-PACCSGIKTLDGM 66
Query  61   AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            A+T  DR+  C CLKSA+ SI GI+ G  A LP  CGVNIPYKISPSTDC+ V+
Sbjct  67   ARTTPDRQATCKCLKSASTSISGINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 24. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 80.4 bits 388,  Expect = 1e-17
 Identities = 54/90 60%, Positives = 68/90 75%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V+S LAPC+ YL   G +   CC GV+ L  AAKT  DR+ AC CLKSA NSIKG
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   AAGLPG CGV++PYKISPSTDC +V+
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 25. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 80.3 bits 387,  Expect = 1e-17
 Identities = 50/109 45%, Positives = 77/109 70%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLLGAAKTP 64
            K++   ++C+VV  P A++++CG+V S ++PC+ Y++  G +   CC G++ L G AKT 
Sbjct  8    KLSLVALLCIVVALPIAQAITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+  C CLK AA  IKG++   AAGLPG CGV++PYKIS +T+C+ V+
Sbjct  68   ADRQATCNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 26. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 80.1 bits 386,  Expect = 2e-17
 Identities = 50/109 45%, Positives = 78/109 71%, Gaps = 1/109 0%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKTP 64
            K++   ++C+VV  P A++++CG+V S ++PC+ Y++  G +   CC G++ L  AAKT 
Sbjct  8    KLSLVALLCIVVALPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTT 67
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+  C CLK A+ +IKG++   AAGLPG CGV++PYKIS ST+C+ V+
Sbjct  68   ADRQATCNCLKQASGAIKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 27. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 79.7 bits 384,  Expect = 2e-17
 Identities = 53/107 49%, Positives = 74/107 69%, Gaps = 3/107 2%
Query  6    KIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTP 64
            K+A  V +CM V   HA  ++C +V++ LAPC+ Y+   G +   CC G+K + G AKT 
Sbjct  8    KLALVVALCMAVSVAHA--ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTT 65
Query  65   EDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             DR+ AC CLK+ A S+ G++ G A  LPG CGVN+PYKIS ST+C+TV+
Sbjct  66   PDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 28. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 79.2 bits 381,  Expect = 3e-17
 Identities = 56/113 49%, Positives = 79/113 69%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K+ C +V CMVV + +AE+L+C +V++ ++PCL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TACTCLK++  + K + +  A  LP  CGV IPYK+S  TDC+ V+
Sbjct  62   AAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 29. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 79.2 bits 381,  Expect = 3e-17
 Identities = 57/109 52%, Positives = 72/109 66%, Gaps = 6/109 5%
Query  6    KIACFVVF--CMVVVAPHA-ESLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAA 61
            K+ C+V    CM V  P A  ++SCG+V + L PC+ Y+   G L   CC GV+ L   A
Sbjct  9    KLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLA 68
Query  62   KTPEDRKTACTCLKSAANSIK--GIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            +T  DR++ C CLK A N I     + G AAGLPG CGVNIPYKISPSTDC T++
Sbjct  69   QTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 30. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 79.0 bits 380,  Expect = 4e-17
 Identities = 58/113 51%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMV+ + +AE+L+C +V++ + PCL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK++  S K + +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 31. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 79.0 bits 380,  Expect = 4e-17
 Identities = 58/113 51%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMV+ + +AE+L+C +V++ + PCL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK++  S K + +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 32. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 79.0 bits 380,  Expect = 4e-17
 Identities = 58/113 51%, Positives = 78/113 69%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMV+ + +AE+L+C +V++ + PCL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK++  S K + +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   AAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 33. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 78.2 bits 376,  Expect = 6e-17
 Identities = 51/103 49%, Positives = 69/103 66%, Gaps = 2/103 1%
Query  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRK 68
            V + ++  A    ++SCG+V S +APC+ Y  G+G  P  GCC GV+ L  AA+T  DR+
Sbjct  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
Query  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS V
Sbjct  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 34. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 77.5 bits 372,  Expect = 1e-16
 Identities = 50/101 49%, Positives = 68/101 67%, Gaps = 2/101 1%
Query  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRK 68
            V + ++  A    ++SCG+V S +APC+ Y  G+G  P  GCC GV+ L  AA+T  DR+
Sbjct  15   VALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRR 74
Query  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCS 111
             AC CLK+AA  + G++ G AA +P  CGV+IPY IS STDCS
Sbjct  75   AACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 35. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 77.3 bits 371,  Expect = 1e-16
 Identities = 57/113 50%, Positives = 79/113 69%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +V++ ++PCL +L+  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+TAC CLK++  S K + +  A  LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 36. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 77.1 bits 370,  Expect = 1e-16
 Identities = 58/113 51%, Positives = 75/113 66%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMVV + +AE+L C +V++ ++ CL YL+  G +   CC GVKGL  
Sbjct  1    MKMM-KFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 59
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK+   S K   +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  60   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 37. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 77.1 bits 370,  Expect = 1e-16
 Identities = 58/113 51%, Positives = 75/113 66%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMVV + +AE+L C +V++ ++ CL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK+   S K   +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 38. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 77.1 bits 370,  Expect = 1e-16
 Identities = 58/113 51%, Positives = 75/113 66%, Gaps = 2/113 1%
Query  1    MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLG 59
            M+M  K  C +V CMVV + +AE+L C +V++ ++ CL YL+  G +   CC GVKGL  
Sbjct  3    MKMM-KFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLND 61
Query  60   AAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            AAKT  DR+TAC CLK+   S K   +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   AAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 39. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 77.1 bits 370,  Expect = 1e-16
 Identities = 56/113 49%, Positives = 78/113 69%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLL 58
            M+M  K+ C ++ CMVV++ +AE+ L+C +V++ + PCL +L+  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+ AC CLK+   S K + +  A  LP  CGVNIPYKIS  TDC+TV+
Sbjct  62   DAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 40. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 76.8 bits 368,  Expect = 2e-16
 Identities = 57/113 50%, Positives = 78/113 69%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +V++ ++PC  +L+  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+TAC CLK++  S K   +  AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   DAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 41. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 75.3 bits 360,  Expect = 5e-16
 Identities = 57/113 50%, Positives = 74/113 65%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +VT  ++PC  +LE  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+ AC CLK++  S        AA LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   DAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 42. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 75.1 bits 359,  Expect = 5e-16
 Identities = 53/109 48%, Positives = 74/109 67%, Gaps = 2/109 1%
Query  6    KIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLLGAAKT 63
            K+ C +V CMVV   +AES L+C +V++ ++PCL YL+  G +   CC GVKGL  A KT
Sbjct  7    KVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKT 66
Query  64   PEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              DR+TAC CLK++  S K + +  A  LP  CG+N+PYK+S  TDC+ V+
Sbjct  67   TPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 43. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 74.7 bits 357,  Expect = 7e-16
 Identities = 54/113 47%, Positives = 78/113 69%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +V++ ++PCL YL+  G +   CC GVKGL 
Sbjct  1    MKMM-KVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLN 59
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             A KT  DR+TAC CLK++  S K + +  A  LP  CG+N+PYK+S  TDC+ V+
Sbjct  60   DATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 44. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 74.4 bits 355,  Expect = 9e-16
 Identities = 55/113 48%, Positives = 74/113 65%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +V++ + PC  +L+  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+ AC CLK+   S K   +  A  LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 45. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 74.4 bits 355,  Expect = 9e-16
 Identities = 55/113 48%, Positives = 74/113 65%, Gaps = 3/113 2%
Query  1    MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLL 58
            M+M  K+ C +V CMVV + +AE+ L+C +V++ + PC  +L+  G +   CC GVKGL 
Sbjct  3    MKMM-KVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLN 61
Query  59   GAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AAKT  DR+ AC CLK+   S K   +  A  LP  CGVNIPYKIS  TDC+ V+
Sbjct  62   DAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 46. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 73.9 bits 353,  Expect = 9e-16
 Identities = 47/90 52%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V+S LAPC+ Y+ G G +   CC G++ +   A+T  DR+TAC CLK  + SI G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   AA LPG CGVNIPYKIS ST+C+TV+
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 47. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 73.4 bits 350,  Expect = 1e-15
 Identities = 45/90 50%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V+S LAPC+PY+ G G +   CC G++ +   A+T  DR+ AC CLK  + S+ G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   AA LPG CGV+IPYKIS ST+C+TV+
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 48. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 73.4 bits 350,  Expect = 1e-15
 Identities = 45/90 50%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V+S LAPC+PY+ G G +   CC G++ +   A+T  DR+ AC CLK  + S+ G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   AA LPG CGV+IPYKIS ST+C+TV+
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 49. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 72.8 bits 347,  Expect = 2e-15
 Identities = 45/90 50%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            ++CG+V+S LAPC+ Y++G G +   CC G++ +   A+T  DR+ AC CLK  + SI G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
            ++   AA LPG CGVN+PYKIS ST+C+TV+
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 50. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.4 bits 339,  Expect = 7e-15
 Identities = 48/100 48%, Positives = 70/100 70%, Gaps = 6/100 6%
Query  11   VVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRK 68
            VV  M++    A ++SCG+V+S L+PC+ Y  G G  P   CC GV+ L  +A++  D++
Sbjct  14   VVAAMLLAVTEA-AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQ 72
Query  69   TACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             AC C+KSAA    G++ GKAAG+P  CGV++PY IS S DCS ++
Sbjct  73   AACKCIKSAA---AGLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 51. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 70.7 bits 335,  Expect = 1e-14
 Identities = 46/99 46%, Positives = 62/99 62%, Gaps = 2/99 2%
Query  15   MVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAKTPEDRKTACT 72
            M+  AP A  +L+CG+V S + PCL Y++G  GP G CC GV+ L   A++  DR+T C 
Sbjct  16   MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCN 75
Query  73   CLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
            CLK  A  I  ++   AA +P  C VN+PY ISP  DCS +
Sbjct  76   CLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 52. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 70.1 bits 332,  Expect = 1e-14
 Identities = 49/91 53%, Positives = 60/91 65%, Gaps = 1/91 1%
Query  24   SLSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIK 82
            +LSCG V S LA C+ YL    PL  GCC GV  L   A+T  DR+ AC CL  AANS  
Sbjct  1    ALSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  83   GIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
             ++  +AA LP  CGVNIPYKIS ST+C++V+
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 53. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 70.1 bits 332,  Expect = 2e-14
 Identities = 46/97 47%, Positives = 61/97 62%, Gaps = 2/97 2%
Query  15   MVVVAPHAE-SLSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAKTPEDRKTACT 72
            M+  AP A  +L+CG+V S + PCL Y++G  GP G CC GV+ L   A++  DR+T C 
Sbjct  16   MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCN 75
Query  73   CLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCS 111
            CLK  A  I  ++   AA +P  C VN+PY ISP  DCS
Sbjct  76   CLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 54. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 68.0 bits 321,  Expect = 6e-14
 Identities = 45/91 49%, Positives = 62/91 68%, Gaps = 2/91 2%
Query  24   SLSCGEVTSGLAPCLPYLEGRGPLGG-CCGGVKGLLGAAKTPEDRKTACTCLKSAANSIK 82
            ++ C  VT  +APC+ YL+  G + G CC G++ + G AKT  DR+  C CLKSAA S+ 
Sbjct  1    AIQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLG 60
Query  83   G-IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114
              I+   AA LPG CGV+IPYKIS S +CS+++
Sbjct  61   SQINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 55. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 67.1 bits 316,  Expect = 1e-13
 Identities = 45/105 42%, Positives = 65/105 61%, Gaps = 3/105 2%
Query  7    IACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-PLGGCCGGVKGLLGAAKTPE 65
            I   +V   ++V P   +++C +VT  L PCLPYL   G P   CC G K LLGA +T  
Sbjct  10   ILAMIVMAQLMVHPSV-AITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQA 68
Query  66   DRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
            DR+TAC C K+AA  +K +    A+ LPG CG++    I+P+ +C+T+
Sbjct  69   DRRTACKCAKTAAPQLK-VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 56. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 64.3 bits 301,  Expect = 7e-13
 Identities = 42/89 47%, Positives = 55/89 61%, Gaps = 1/89 1%
Query  25   LSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            + CG V S + PCL Y++G  GP G CC GVK L   A++  DR++AC CLK  A  I  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
            ++   A  +P  CGVN+PY IS + DCS V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 57. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 63.4 bits 296,  Expect = 2e-12
 Identities = 41/105 39%, Positives = 66/105 62%, Gaps = 3/105 2%
Query  7    IACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYL-EGRGPLGGCCGGVKGLLGAAKTPE 65
            +  + VF + +VA  A  ++CG+V + LAPC+P+L +G  P   CC GV+ L G  ++ +
Sbjct  9    LVVLAVFQLAMVARGA--ITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSD 66
Query  66   DRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113
            DR+TAC C+K+AAN    +    A  LP  CG+++   IS + +C T+
Sbjct  67   DRRTACNCVKAAANRYPNLKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 58. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 52.4 bits 236,  Expect = 4e-09
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  19   APHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  33   APGSEE-TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQT 91
Query  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  92   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 130

Sequence Alignment: 59. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 51.9 bits 233,  Expect = 8e-09
 Identities = 37/93 39%, Positives = 54/93 58%, Gaps = 7/93 7%
Query  19   APHAESLSCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
            AP +E  +CG V   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++
Sbjct  34   APGSEE-TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQT 92
Query  77   AANSIKGIDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113
            A  +   ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  93   AMKTYSDIDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 131

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 50.9 bits 228,  Expect = 1e-08
 Identities = 34/87 39%, Positives = 50/87 57%, Gaps = 6/87 6%
Query  26   SCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            +CG +   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  84   IDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113
            ID    + +P  CG+ +  K+ P   + DC TV
Sbjct  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 94

Sequence Alignment: 61. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 50.2 bits 224,  Expect = 2e-08
 Identities = 33/87 37%, Positives = 50/87 57%, Gaps = 6/87 6%
Query  26   SCGEVTSGLAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
            +CG +   L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  84   IDTGKAAGLPGVCGVNIPYKISP---STDCSTV 113
            ID    + +P  CG+ +  K+ P   + DC T+
Sbjct  63   IDGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTL 94

Sequence Alignment: 62. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 48.7 bits 216,  Expect = 5e-08
 Identities = 34/95 35%, Positives = 50/95 52%, Gaps = 5/95 5%
Query  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
            AP      CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+ +
Sbjct  27   APAPGEGPCGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVA 86
Query  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114
            A   I GI     A +P  CG+   +P  I+   DCS ++
Sbjct  87   ATKGISGIKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 63. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 47.8 bits 211,  Expect = 1e-07
 Identities = 34/95 35%, Positives = 49/95 51%, Gaps = 5/95 5%
Query  19   APHAESLSCGEVTSGLAPCLPYLEG--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKS 76
            AP     +CG+V   + PCL +++G  + P   CC G K L    KT E ++ AC C+  
Sbjct  27   APAPGEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVR 86
Query  77   AANSIKGIDTGKAAGLPGVCGVN--IPYKISPSTDCSTVQ 114
            A   I GI     A +P  C +   +P  I+   DCS +Q
Sbjct  87   ATKGISGIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 64. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 46.8 bits 206,  Expect = 2e-07
 Identities = 32/79 40%, Positives = 46/79 58%, Gaps = 6/79 7%
Query  34   LAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAG 91
            L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   ID    + 
Sbjct  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
Query  92   LPGVCGVNIPYKISP---STDCSTV 113
            +P  CG+ +  K+ P   + DC TV
Sbjct  65   VPKHCGI-VDSKLPPIDVNMDCKTV 88

Sequence Alignment: 65. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 45.0 bits 196,  Expect = 6e-07
 Identities = 33/89 37%, Positives = 43/89 48%, Gaps = 2/89 2%
Query  22   AESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSI 81
            A S +C  V + LAPC  +L G+ P   CC GV  L  + KT  DR   C C+K    SI
Sbjct  25   AASPTCDTVQNILAPCAGFLTGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI 84
Query  82   KGIDTGKAAGLPGVCGVNIPYK-ISPSTDCS 111
               D  +   L   CGV   +  +  + DCS
Sbjct  85   -AYDPKRMPLLSTKCGVKPDFPAVDKNLDCS 114

Sequence Alignment: 66. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 30.9 bits 121,  Expect = 0.003
 Identities = 16/34 47%, Positives = 25/34 73%, Gaps = 1/34 2%
Query  24   SLSCGEVTSGLAPCLPYLEGRGPL-GGCCGGVKGL 57
            +L+C +V++ ++PCL YL+  G +   CC GVKGL
Sbjct  1    ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL 35

Sequence Alignment: 67. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 30.7 bits 120,  Expect = 0.004
 Identities = 17/32 53%, Positives = 22/32 68%, Gaps = 3/32 9%
Query  24   SLSCGEVTSGLAPCLPYLEGRG---PLGGCCGGVK 55
            S++C +V+  L PCL YL+  G   P G CC GVK
Sbjct  1    SITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

Sequence Alignment: 68. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 29.8 bits 115,  Expect = 0.007
 Identities = 14/28 50%, Positives = 21/28 75%, Gaps = 2/28 7%
Query  24   SLSCGEVTSGLAPCLPYLEGRG--PLGGCC 51
            +++CG+V S L+PC+ YL+  G  P G CC
Sbjct  1    TVTCGQVASALSPCIDYLQKDGAVPAGSCC 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.