The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE
GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF
HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA13604 Dau c 1.0102 154 949 214.2 1.2e-57
AAB01092 Dau c 1.0101 168 933 210.7 1.6e-56
CAB03716 Dau c 1.0104 154 930 210.1 2.2e-56
CAB06416 Dau c 1.0105 154 930 210.1 2.2e-56
CAB03715 Dau c 1.0103 154 917 207.3 1.5e-55
P49372 Api g 1 154 804 182.7 3.8e-48
CAA67246 Pet c PR10 155 577 133.4 2.7e-33
AAL76932 Dau c 1.0201 154 491 114.8 1.1e-27
P92918 Api g 1.0201 159 487 113.9 2.1e-27
O50001 Pru ar 1 160 439 103.4 2.9e-24
CAM31908 Act c 8.0101 159 437 103.0 3.9e-24
CAM31909 Act d 8.0101 157 430 101.5 1.1e-23
AAB92255 Tar o RAP 157 412 97.6 1.7e-22
CAD10374 Cas s 1 160 412 97.6 1.7e-22
B6CQS9 Pru du 1.0101 160 411 97.3 2e-22
ACJ23864 Fag s 1.0101 160 405 96.0 4.9e-22
CAA96535 Mal d 1.0401 160 401 95.2 9e-22
CAA96536 Mal d 1.0402 160 394 93.7 2.6e-21
CAA96537 Mal d 1.0403 160 392 93.2 3.5e-21
CAA54421 Bet v 1.0201 160 390 92.8 4.7e-21
CAA54481 Bet v 1.0202 160 389 92.6 5.5e-21
P43186 Bet v 1.0204 160 389 92.6 5.5e-21
P43184 Bet v 1.0203 160 388 92.3 6.4e-21
Q39427 Bet v 1.0205 160 387 92.1 7.4e-21
APD76154 Jug r 5.0101 160 387 92.1 7.4e-21
Q256S7 Fra a 1 160 385 91.7 1e-20
Q256S6 Fra a 1 160 385 91.7 1e-20
Q3T923 Fra a 1 160 384 91.5 1.2e-20
ABZ81046 Que a 1.0301 160 383 91.3 1.4e-20
CAB02217 Car b 1.0302 161 383 91.3 1.4e-20
CAB02160 Bet v 1.0113 160 382 91.0 1.6e-20
AAB24432 Aln g 1 160 381 90.8 1.8e-20
CAB02216 Car b 1.0301 161 381 90.8 1.8e-20
AAO25113 Mal d 1.0304 159 379 90.4 2.4e-20
AAK13027 Mal d 1.0302 159 379 90.4 2.4e-20
CAB02208 Car b 1.0105 160 379 90.4 2.5e-20
CAB02209 Car b 1.0106 160 379 90.4 2.5e-20
CAA96534 Mal d 1.0301 159 378 90.2 2.8e-20
Q2I6V8 Pru p 1.0101 160 378 90.2 2.9e-20
ABZ81047 Que a 1.0401 160 378 90.2 2.9e-20
Q256S2 Fra a 1 160 378 90.2 2.9e-20
AUH28179 Que m 1.0101 160 378 90.2 2.9e-20
CAA33887 Bet v 1.0101 160 377 90.0 3.3e-20
CAB02159 Bet v 1.0112 160 377 90.0 3.3e-20
O24248 Pru av 1 160 376 89.7 3.9e-20
CAB02207 Car b 1.0104 160 376 89.7 3.9e-20
CAB02161 Bet v 1.0114 160 376 89.7 3.9e-20
NP_001275580 Sola l 4.0201 160 376 89.7 3.9e-20
ABZ81042 Car b 1.0111 160 376 89.7 3.9e-20
ABZ81043 Car b 1.0112 160 376 89.7 3.9e-20
CAB02156 Bet v 1.0109 160 376 89.7 3.9e-20
CAB02206 Car b 1.0103 160 376 89.7 3.9e-20
ABZ81041 Car b 1.0110 160 375 89.5 4.5e-20
ABZ81040 Car b 1.0109 160 375 89.5 4.5e-20
P38948 Aln g 1 159 374 89.3 5.2e-20
CAA04828.1 Bet v 1.0206 159 374 89.3 5.2e-20
CAA54696.1 Bet v 1.0301 160 374 89.3 5.2e-20
CAA07329.1 Bet v 1.0118 160 374 89.3 5.2e-20
AFN42528 Can s 5.0101 161 374 89.3 5.3e-20
Q256S4 Fra a 1 159 373 89.1 6e-20
CAA96549 Cor a 1.0301 160 373 89.1 6.1e-20
CAA96548 Cor a 1.0201 160 373 89.1 6.1e-20
CAA50325 Cor a 1.0103 160 372 88.9 7.1e-20
CAB02215 Car b 1.0108 160 372 88.9 7.1e-20
CAB02213 Car b 1.0107 160 372 88.9 7.1e-20
QGS84240 Que i 1.0101 159 370 88.4 9.5e-20
ADK39021 Ost c 1.0101 160 370 88.4 9.6e-20
CAA54484 Bet v 1.0104 160 370 88.4 9.6e-20
CAA54482 Bet v 1.0102 160 368 88.0 1.3e-19
ACF75030.1 Bet v 1.0207 150 367 87.8 1.4e-19
CAA54483 Bet v 1.0103 160 367 87.8 1.5e-19
CAA54487 Bet v 1.0106 160 367 87.8 1.5e-19
AAK13028 Mal d 1.0303 159 366 87.6 1.7e-19
ABZ81044 Car b 1.0113 160 366 87.6 1.7e-19
CAB02157 Bet v 1.0110 160 366 87.6 1.7e-19
CAA50327 Cor a 1.0101 160 366 87.6 1.7e-19
CAA96547 Bet v 1.0115 160 364 87.1 2.4e-19
CAA50328 Cor a 1.0102 160 364 87.1 2.4e-19
CAA54489 Bet v 1.0107 160 364 87.1 2.4e-19
CAA07323.1 Bet v 1.0117 160 364 87.1 2.4e-19
CAA04827.1 Bet v 1.0116 159 363 86.9 2.7e-19
CAB02155 Bet v 1.0108 160 363 86.9 2.7e-19
CAA50326 Cor a 1.0104 160 361 86.5 3.7e-19
Q08407 Cor a 1 159 359 86.1 5e-19
ABZ81045 Que a 1.0201 159 359 86.1 5e-19
CAA47357 Car b 1.0102 159 358 85.8 5.8e-19
CAA54485 Bet v 1.0105 160 358 85.8 5.8e-19
AAD13683 Mal d 1.0206 159 355 85.2 9.1e-19
P38950 Car b 1 159 355 85.2 9.1e-19
CAB02158 Bet v 1.0111 160 355 85.2 9.1e-19
AAG40329 Cor a 1.0402 161 349 83.9 2.3e-18
AAG40331 Cor a 1.0404 161 349 83.9 2.3e-18
AAD26545 Mal d 1.0202 159 347 83.4 3e-18
AAB01362 Mal d 1.0201 159 347 83.4 3e-18
ABC41615.1 Bet v 1.0119 150 345 83.1 3.7e-18
P38949 Car b 1 159 345 83.0 4.1e-18
AAD26548 Mal d 1.0204 159 343 82.6 5.5e-18
O65200 Pyr c 1 159 343 82.6 5.5e-18
AAK13030 Mal d 1.0207 159 343 82.6 5.5e-18
AAD26555 Mal d 1.0107 159 343 82.6 5.5e-18
AAD48405 Cor a 1.0401 161 343 82.6 5.6e-18
AAG40330 Cor a 1.0403 161 343 82.6 5.6e-18
CAD32318 Mal d 1.0208 158 341 82.1 7.4e-18
AAD26547 Mal d 1.0203 159 341 82.1 7.5e-18
QOL10866 Que ac 1.0101 159 341 82.1 7.5e-18
CAA58646 Mal d 1.0101 159 340 81.9 8.7e-18
AAD26558 Mal d 1.0205 159 339 81.7 1e-17
AAD26554 Mal d 1.0106 159 339 81.7 1e-17
AAD26546 Mal d 1.0103 159 338 81.5 1.2e-17
AAK13029 Mal d 1.0109 159 338 81.5 1.2e-17
AAD29671 Mal d 1.0108 159 338 81.5 1.2e-17
AAD26552 Mal d 1.0104 159 337 81.3 1.4e-17
AAD26553 Mal d 1.0105 159 336 81.1 1.6e-17
CAA88833 Mal d 1.0102 159 335 80.8 1.8e-17
AHC08073 Sola l 4.0101 160 335 80.8 1.9e-17
CAA43637 Pha v 1 156 321 77.8 1.5e-16
EF436550 Ara h 8.0201 153 319 77.4 1.9e-16
P25985 Pha v 1 155 314 76.3 4.2e-16
Q2VU97 Vig r 1.0101 155 313 76.1 4.9e-16
Q0Z8U9 Rub i 1.0101 137 306 74.7 1.2e-15
CAA42646 Gly m 4 158 303 73.9 2.3e-15
CAA75803 Lyc e 4.0101 178 301 73.4 3.7e-15
CAA43636 Pha v 1 155 299 73.0 4e-15
AAQ91847 Ara h 8.0101 157 289 70.9 1.8e-14
Q5ULZ4 Fra a 1.0101 100 161 43.4 2.2e-06
Q9ZWP8 Vig r 6.0101 155 126 35.5 0.00082
P85126 Que a 1.0101 50 107 32.2 0.0025
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 214.2 bits 949,  Expect = 1e-57
 Identities = 154/154 100%, Positives = 154/154 100%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 2. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 210.7 bits 933,  Expect = 2e-56
 Identities = 152/154 98%, Positives = 152/154 98%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIF  IVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 74
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF
Sbjct  75   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 134
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  135  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 3. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 210.1 bits 930,  Expect = 2e-56
 Identities = 151/154 98%, Positives = 152/154 98%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPITSMTVRTDAVNKEALTYDSTVIDGDILL FIESIETH+VVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFAD QNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 4. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 210.1 bits 930,  Expect = 2e-56
 Identities = 151/154 98%, Positives = 153/154 99%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSV+VKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPITSMTVRTDAVNKEALTYDSTVIDGDILL FIESIETH+VVVPTADGGSITKTTAIF
Sbjct  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 5. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 207.3 bits 917,  Expect = 2e-55
 Identities = 149/154 96%, Positives = 152/154 98%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAA GAYKSV+VKGDGGAGTVRIITLPE
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSPIT+MTVRTDAVNKEAL+YDSTVIDGDILL FIESIETHMVVVPTADGGSITKTTAIF
Sbjct  61   GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Sbjct  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 6. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 182.7 bits 804,  Expect = 4e-48
 Identities = 123/154 79%, Positives = 141/154 91%, Gaps = 0/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE 60
            MG Q+H LE+TSSVSAEKIF G V+DVDTV+PKAAPGAYKSV++KGDGG GT++IITLP+
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            G PIT+MT+R D VNKEALT+D +VIDGDILL FIESIE H+V+VPTADGGSI KTTAIF
Sbjct  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGDAVVPEENIK+A+ QNTALFKA+EAYLIAN
Sbjct  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 7. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 133.4 bits 577,  Expect = 3e-33
 Identities = 85/154 55%, Positives = 117/154 75%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG Q   + ITSSV A K+F  + LD+DT++P+  PGA K  ++ +GDGG GTV+++TL 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            + SP  +M  + DA++KEA+T+  ++IDGDILL +I+SI  H+  VPTADGG    +TA+
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            F+TKGDAVVPEENIKFA+ QN  +FKA+EAYL+AN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 8. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 114.8 bits 491,  Expect = 1e-27
 Identities = 78/153 50%, Positives = 107/153 69%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG Q   +E  S+VSAEK++ G +LD+DTV PK  P   KSV++ +GDGG GTVR++ L 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E +  T+M  + D ++K  L Y  T I GDIL+E +ES+  + VVVPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGDAV+PE+ +K A  ++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 9. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 113.9 bits 487,  Expect = 2e-27
 Identities = 77/153 50%, Positives = 106/153 69%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG Q   +E  S+VSAEK++ G +LD+DTV PK  P   KSV++ +GDGG GTV+++ L 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E +  T+M  + D ++K  L Y  T I GDIL++ +ES+    VVVPT DGG I K T I
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGDAV+PE+ IK A  ++   FKA+EAYL+AN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 10. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 103.4 bits 439,  Expect = 3e-24
 Identities = 67/154 43%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +  EK+F   +LD D +IPK AP A K  ++ +GDGG GT++ +T+ 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D ++K+ L+Y  T+I+GD L + IE+I   + +V + DGGSI KTT+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE +K    +   LFK +EAYL+AN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLAN 155

Sequence Alignment: 11. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 103.0 bits 437,  Expect = 4e-24
 Identities = 70/154 45%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++ +EI S V   K++   +LD DT++PK  P A K V + +GDG AGT++ +T+ 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R DA++K+ LTY  T+I+GD+L E  ESI  H+ +V   DGGSI K  +I
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 12. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 101.5 bits 430,  Expect = 1e-23
 Identities = 72/153 47%, Positives = 101/153 66%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MGA ++ +EI SS+SAEK+F   VLD DT+IPKA P A   V  ++GDGG GT+++ T+ 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS   S+  R D ++KE +TY  ++I+G  L +  ESI  H+ +V T DGG I K  +I
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +  K DA V EE IK    + + +FK +EAYL+AN
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 13. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 97.6 bits 412,  Expect = 2e-22
 Identities = 62/147 42%, Positives = 94/147 63%, Gaps = 1/147 0%
Query  8    LEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITS 66
            +EITSS+S   IF   V+D DT+ PKA P  YKS+  ++GDGG GT++ IT  +G P TS
Sbjct  6    FEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTS 65
Query  67   MTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDA 126
               + DA++   ++   T+ +GD+L+  IES   H+  +P+ADGGS+ K + +F  KGDA
Sbjct  66   SKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDA 125
Query  127  VVPEENIKFADAQNTALFKAIEAYLIAN 154
             + +EN+ +        FKAIE Y+I++
Sbjct  126  KLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 14. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 97.6 bits 412,  Expect = 2e-22
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +H  EITS++   ++F   VLD D +IPK AP A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D +++  +TY  +VI+GD++ E++E I   + +V + DGGSI K T+ 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  + EE +     +   LFKA+EAYL+A+
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 15. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 97.3 bits 411,  Expect = 2e-22
 Identities = 62/154 40%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +++ E TS +   ++F  +VL+ DT+IPK AP + KS + V+GDGG GT++ I++ 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS  + +  + D ++K+ + Y+ ++++GD L + +E I   + +V +ADGGS+ K+T+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE++K    + T LFK IE YL+AN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVAN 155

Sequence Alignment: 16. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 96.0 bits 405,  Expect = 5e-22
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E T+ ++  ++F   VLD D +IPK AP A KS ++ +G GG GT++ IT+ 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D ++   +TY  T+I+GD + E +E I   + +V + DGGSI K+T+ 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + E+ IK    + + +FKA+EAYL+AN
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLAN 155

Sequence Alignment: 17. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 95.2 bits 401,  Expect = 9e-22
 Identities = 61/154 39%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS ++ +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ +TY  ++I+GD L + +E I     ++ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 18. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 93.7 bits 394,  Expect = 3e-21
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS  + +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ +TY  ++I+GD L + +E I     ++ + DGGSI KT + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 19. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 93.2 bits 392,  Expect = 3e-21
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS ++ +GDGG GT++ +T+ 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R + ++K+ +TY  ++I+GD L + +E I     ++ + DGGSI KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +  KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 20. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 92.8 bits 390,  Expect = 5e-21
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 21. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 92.6 bits 389,  Expect = 5e-21
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 22. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 92.6 bits 389,  Expect = 5e-21
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 23. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 92.3 bits 388,  Expect = 6e-21
 Identities = 61/154 39%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ DT+IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 24. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 92.1 bits 387,  Expect = 7e-21
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 25. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 92.1 bits 387,  Expect = 7e-21
 Identities = 61/154 39%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ I + 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  RTDA+++  +TY  +VI+GD L + IE I     +V + +GGSI K+ + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H+KGD  + EE++K    + + LFKA+E YL+A+
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 91.7 bits 385,  Expect = 1e-20
 Identities = 63/151 41%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  TY  ++I+GD L + IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 27. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 91.7 bits 385,  Expect = 1e-20
 Identities = 63/151 41%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  TY  ++I+GD L + IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 28. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 91.5 bits 384,  Expect = 1e-20
 Identities = 62/151 41%, Positives = 93/151 61%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++KE  TY  ++I+GD L + IE I+    +V    GG++ KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    + + LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 152

Sequence Alignment: 29. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 91.3 bits 383,  Expect = 1e-20
 Identities = 60/154 38%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E +TY  +VI+GD L++ +E++ T   +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAH 155

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 91.3 bits 383,  Expect = 1e-20
 Identities = 63/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP+  +  R + V+   + Y  TVI+G  + + +E I   + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 31. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 91.0 bits 382,  Expect = 2e-20
 Identities = 58/154 37%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 32. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 90.8 bits 381,  Expect = 2e-20
 Identities = 59/154 38%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ IT+P
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V++  + Y  +VI+G  + + +E +   + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FHTKGD  +  E IK    +   L+KA+E+YL+A+
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 33. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 90.8 bits 381,  Expect = 2e-20
 Identities = 62/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK +P A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP+  +  R + V+   + Y  TVI+G  + + +E I   + +V   DGGSI K T+ 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 34. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 90.4 bits 379,  Expect = 2e-20
 Identities = 64/149 42%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 35. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 90.4 bits 379,  Expect = 2e-20
 Identities = 64/149 42%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+K+ + Y  +VI+GD + E IE I  ET +V    A  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVA---AGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 36. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 90.4 bits 379,  Expect = 2e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 37. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 90.4 bits 379,  Expect = 2e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 38. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 90.2 bits 378,  Expect = 3e-20
 Identities = 64/151 42%, Positives = 97/151 64%, Gaps = 6/151 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTK D  + EE++K    + + LFK IE YL+A+
Sbjct  118  SHYHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 39. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 90.2 bits 378,  Expect = 3e-20
 Identities = 63/149 42%, Positives = 96/149 64%, Gaps = 5/149 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+++KE  +Y  T+I+GD L + +E I  ET +V  P+  GGSI K+T
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPS--GGSIIKST 118
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  119  SHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 40. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 90.2 bits 378,  Expect = 3e-20
 Identities = 59/154 38%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E +TY  +VI+GD L++ +E++ T   +V + DGGSI K+T+ 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 41. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 90.2 bits 378,  Expect = 3e-20
 Identities = 63/151 41%, Positives = 91/151 60%, Gaps = 1/151 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  +  +++K   TY  ++I+GD L E IE I+    +V    GG+I KTT+ 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    +   LFK IE YL
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYL 152

Sequence Alignment: 42. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 90.2 bits 378,  Expect = 3e-20
 Identities = 59/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E  S +   ++F   VLD D +IPK  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS +     R D ++ E +T+  +VI+GD L++ +E++ T   +V + DGGSI K+T  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + +E I+    + + +FKA+EAYL+A+
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAH 155

Sequence Alignment: 43. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 90.0 bits 377,  Expect = 3e-20
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 44. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 90.0 bits 377,  Expect = 3e-20
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI K +  
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 45. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 62/149 41%, Positives = 96/149 64%, Gaps = 5/149 3%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D ++PK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+++KE  +Y  T+I+GD L + +E I  ET +V  P+  GGSI K+T
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPS--GGSIIKST 118
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKG+  + EE++K    + + LFK IE YL
Sbjct  119  SHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYL 152

Sequence Alignment: 46. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 47. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 59/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  + + E T++++  ++F G+VLD D+++PK      KS++ V+GDGGAG+++ + + 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GD+L + +ESI   +      DGG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155

Sequence Alignment: 49. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 50. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 51. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 52. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 89.7 bits 376,  Expect = 4e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 53. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 89.5 bits 375,  Expect = 5e-20
 Identities = 61/154 39%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGS+ K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 54. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 89.5 bits 375,  Expect = 5e-20
 Identities = 62/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 55. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 89.3 bits 374,  Expect = 5e-20
 Identities = 58/153 37%, Positives = 93/153 60%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ IT+PE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V++  + Y  +VI+G  + + +E +   + +V   DGGSI K +  F
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  +  E IK    +   L+KA+E+YL+A+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 56. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 89.3 bits 374,  Expect = 5e-20
 Identities = 59/153 38%, Positives = 95/153 62%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ IT+PE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  +
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  +  E++K    +   L++A+E+YL+A+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 57. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 89.3 bits 374,  Expect = 5e-20
 Identities = 60/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS ++  ++F   VLD D +IPK AP    S + ++G+GG GT++ IT+P
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    M  R D ++   + Y  ++I+G  L + +E I   + +V    GGSI K T+ 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  + EE IK    +   LFKA+E YL+A+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAH 155

Sequence Alignment: 58. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 89.3 bits 374,  Expect = 5e-20
 Identities = 58/154 37%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI + +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 59. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 89.3 bits 374,  Expect = 5e-20
 Identities = 58/151 38%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TSS++  ++F   VLD D ++PK AP A + V++ +G+GG GT++ IT+ 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILL-EFIESIETHMVVVPTADGGSITKTTA 118
            +G P   +  + +A++KE+LTY  ++I+GD L    +E I     +V + DGG++ KT +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  IFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
             +++ GDA V EE +K  + Q T ++K +EAYL
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYL 153

Sequence Alignment: 60. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 89.1 bits 373,  Expect = 6e-20
 Identities = 65/148 43%, Positives = 94/148 63%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS + A K+F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  +  +++KE  TY  ++I+GD L + IE I  ET +V  P    G+I KTT
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPH---GTIIKTT 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    + + LFK IE YL
Sbjct  118  SKYHTKGDVEIKEEHVKAGKEKASHLFKLIEGYL 151

Sequence Alignment: 61. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 89.1 bits 373,  Expect = 6e-20
 Identities = 57/154 37%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  E TS +   ++F   VLD D +IPK AP A KS+++ +G+GG GT++ I + 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  + + +++  ++Y  +VI+GD L + +E I   + +V +  GGSI K+ + 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HT GD  + +E IK    + + LFKA+E YL+A+
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 62. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 89.1 bits 373,  Expect = 6e-20
 Identities = 62/154 40%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD + +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R + V+   + Y  TVI+G  + + +E I   + +V   DGGSI K +  
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E+IK    +   LF+A+EAYL+A+
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 63. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 88.9 bits 372,  Expect = 7e-20
 Identities = 63/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E IK A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 64. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 88.9 bits 372,  Expect = 7e-20
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + +  TVI+GD+L + +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 65. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 88.9 bits 372,  Expect = 7e-20
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + +  TVI+GD+L + +E +   + +V    GGSI K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 66. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 88.4 bits 370,  Expect = 9e-20
 Identities = 63/153 41%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +H  + TS +   ++F   VLD D +IPK  P A KS++ ++G+GG GT++ IT+ 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E S       R DA++ E  TY  +VI+GD L + + S+ T +  V + DGGSI K+T  
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154

Sequence Alignment: 67. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 88.4 bits 370,  Expect = 1e-19
 Identities = 61/154 39%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A   V+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 68. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 88.4 bits 370,  Expect = 1e-19
 Identities = 58/154 37%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++ +E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  + + +E I   + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 69. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 88.0 bits 368,  Expect = 1e-19
 Identities = 55/154 35%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++ +E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I +P
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 70. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 87.8 bits 367,  Expect = 1e-19
 Identities = 57/144 39%, Positives = 91/144 63%, Gaps = 1/144 0%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
            E TS + A ++F   +L+ D +IPK AP A  SV+ ++G+GG GT++ IT+PEGSP   +
Sbjct  6    ETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPFKYV 65
Query  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              R D V+   + Y  ++I+G  L + +E I   + +V T DGGSI K +  +HTKGD  
Sbjct  66   KERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHE 125
Query  128  VPEENIKFADAQNTALFKAIEAYLI 152
            +  E++K    +  AL++A+E+YL+
Sbjct  126  MKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 71. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 87.8 bits 367,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  + + +E I   + +V T +GGSI K    
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 72. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 87.8 bits 367,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  +VI+G  + + +E I   + +V T +GGSI K    
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 73. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 87.6 bits 366,  Expect = 2e-19
 Identities = 60/149 40%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++ +E TS +   ++++  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS  + +  + D V+K+ + Y  +VI+GD + E IE I  ET +V    +  GS+ K+ 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVA---SGSGSVIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 74. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 87.6 bits 366,  Expect = 2e-19
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 75. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 87.6 bits 366,  Expect = 2e-19
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 76. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 87.6 bits 366,  Expect = 2e-19
 Identities = 61/154 39%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 77. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 87.1 bits 364,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V  + + Y  +VI+G  + + +E I   + +V T DG SI K +  
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 78. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 87.1 bits 364,  Expect = 2e-19
 Identities = 60/154 38%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   + Y  TVI+GD+L + +E + + + +V    GGSI K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 79. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 87.1 bits 364,  Expect = 2e-19
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D ++PK AP A  SV+ ++G+GG GT++ I +P
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 80. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 87.1 bits 364,  Expect = 2e-19
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 86.9 bits 363,  Expect = 3e-19
 Identities = 56/153 36%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++PE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            G P   +  R D V+   + Y  ++I+G  + + +E I   + +V T DGGSI K +  +
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            HTKGD  V  E +K +      L++A+E+YL+A+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 82. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 86.9 bits 363,  Expect = 3e-19
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 83. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 86.5 bits 361,  Expect = 4e-19
 Identities = 60/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++ +E  S +SA ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D V+   + Y  TVI+GD+L + +E + + + +V    GGS  K ++ 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 84. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 86.1 bits 359,  Expect = 5e-19
 Identities = 60/153 39%, Positives = 92/153 60%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KGD  +  E +K A      L++A+E YL+A+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 85. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 86.1 bits 359,  Expect = 5e-19
 Identities = 62/153 40%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG GT++ IT+ 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E S       R DA++ E  TY  +VI+GD L   +ES+ T +  V + DGGSI K+T  
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKGD  + EE I+ A  +   L+KA+EAYL+A+
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAH 154

Sequence Alignment: 86. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 85.8 bits 358,  Expect = 6e-19
 Identities = 60/153 39%, Positives = 91/153 59%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 87. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 85.8 bits 358,  Expect = 6e-19
 Identities = 55/154 35%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +L+ D +IPK AP A  SV+ ++G+GG GT++ I +P
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 88. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 85.2 bits 355,  Expect = 9e-19
 Identities = 61/148 41%, Positives = 92/148 62%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F G VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 89. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 85.2 bits 355,  Expect = 9e-19
 Identities = 56/153 36%, Positives = 94/153 61%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E TS + A ++F   +LD + +IPK +P A  SV+ V+G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            GSP+  +  R + ++   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 90. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 85.2 bits 355,  Expect = 9e-19
 Identities = 54/154 35%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
             G P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG + K +  
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKG+  V  E +K +      L++A+E+YL+A+
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 83.9 bits 349,  Expect = 2e-18
 Identities = 60/153 39%, Positives = 90/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  S+  E TS +   ++F   VLD D +IPK AP  +   + ++G+GG GT++ IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 92. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 83.9 bits 349,  Expect = 2e-18
 Identities = 60/153 39%, Positives = 91/153 59%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  S+  E TS +   ++F   VLD D +IPK AP  + S + ++G+GG GT++ IT+ 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EG+    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 93. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 83.4 bits 347,  Expect = 3e-18
 Identities = 60/148 40%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 94. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 83.4 bits 347,  Expect = 3e-18
 Identities = 60/148 40%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 95. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 83.1 bits 345,  Expect = 4e-18
 Identities = 53/148 35%, Positives = 88/148 59%, Gaps = 1/148 0%
Query  5    SHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSV-DVKGDGGAGTVRIITLPEGSP 63
            ++  E TS + A ++F   +LD D + PK AP A  SV +++G+GG GT++ I +PEG P
Sbjct  2    NYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFP 61
Query  64   ITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTK 123
               +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGG I K +  +HTK
Sbjct  62   FKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTK 121
Query  124  GDAVVPEENIKFADAQNTALFKAIEAYLI 152
            G+  V  E +K +      L++A+E+YL+
Sbjct  122  GNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 96. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 83.0 bits 345,  Expect = 4e-18
 Identities = 58/153 37%, Positives = 89/153 58%, Gaps = 1/153 0%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPE 60
            G  ++  E  S + A ++F   VLD D +IPK AP    SV+ V G+GG GT++ IT+ E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIF 120
            G P   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ F
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            H KG   V  E +K A      L++A+E+YL+A+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 97. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 59/148 39%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET ++    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 98. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 57/150 38%, Positives = 90/150 60%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V +  G +I K+ + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 99. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 60/148 40%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT + IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 100. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 57/150 38%, Positives = 90/150 60%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K   A+   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYL 151

Sequence Alignment: 101. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 59/153 38%, Positives = 90/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG   +  E TS +   ++F   VLD D +IPK AP  + S + ++G+GG GT++ IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EG+    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 102. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 82.6 bits 343,  Expect = 6e-18
 Identities = 59/153 38%, Positives = 89/153 58%, Gaps = 4/153 2%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG   +  E TS +   ++F   VLD D +IPK AP  +   + ++G+GG GT++ IT+ 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    M  + + ++   + Y  ++I+G  L   +E I  E  M   P   GGSI K T
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHG-GGSILKIT 119
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + +HTKG+A + EE IK    +   LFKA+EAYL+A+
Sbjct  120  SKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAH 156

Sequence Alignment: 103. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 82.1 bits 341,  Expect = 7e-18
 Identities = 59/147 40%, Positives = 91/147 61%, Gaps = 6/147 4%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLPE 60
            G  ++  E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  61   GSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTTA 118
            GS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSIS 117
Query  119  IFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
             +HTKGD  + EE++K    +   LFK IE+YL
Sbjct  118  HYHTKGDVEIMEEHVKAGKEKAHGLFKLIESYL 150

Sequence Alignment: 104. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 82.1 bits 341,  Expect = 7e-18
 Identities = 59/148 39%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++K    +   LFK IE++L
Sbjct  118  SHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESHL 151

Sequence Alignment: 105. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 82.1 bits 341,  Expect = 7e-18
 Identities = 60/153 39%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  ++  + TS +   ++F   VLD D +I K  P A KS ++ +G+GG GT++  T+ 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E S +     R D ++ E  +Y  +VI+G+ L + I SI T +  V + DGGSI K+T  
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            ++TKG   + EE I+ A  + T LFKA+EAYL+A+
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAH 154

Sequence Alignment: 106. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 81.9 bits 340,  Expect = 9e-18
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 107. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 81.7 bits 339,  Expect = 1e-17
 Identities = 59/148 39%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +GDGG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
            EGS    +  + D+V++   +Y  T+I+GD L + IE +  ET +V    +  GSI K+ 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVA---SGSGSIIKSI 117
Query  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            + +HTKGD  + EE++     +   LFK IE+YL
Sbjct  118  SHYHTKGDVEIKEEHVMAGKEKAHGLFKLIESYL 151

Sequence Alignment: 108. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 81.7 bits 339,  Expect = 1e-17
 Identities = 56/150 37%, Positives = 90/150 60%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE+I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 109. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 81.5 bits 338,  Expect = 1e-17
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 110. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 81.5 bits 338,  Expect = 1e-17
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYL 151

Sequence Alignment: 111. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 81.5 bits 338,  Expect = 1e-17
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 112. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 81.3 bits 337,  Expect = 1e-17
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 113. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 81.1 bits 336,  Expect = 2e-17
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 114. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 80.8 bits 335,  Expect = 2e-17
 Identities = 55/150 36%, Positives = 88/150 58%, Gaps = 2/150 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151
            +H KG+  + EE++K    +   LFK IE+YL
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYL 151

Sequence Alignment: 115. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 80.8 bits 335,  Expect = 2e-17
 Identities = 54/154 35%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ + ++GDGG G+++ + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GDIL E +ESI   +      +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGD VV EE       +   + KA+EAYL+AN
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 77.8 bits 321,  Expect = 1e-16
 Identities = 52/154 33%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +   + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +H+KGDA   E+ +K   A++ +LFKA+EAYL+AN
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 77.4 bits 319,  Expect = 2e-16
 Identities = 56/152 36%, Positives = 90/152 59%, Gaps = 3/152 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG ++   E TS V   K+F   V+D D + PK  P A +S++ V+G+GG GTV+ +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E    + +  + DA+++   TYD T+  G  + E +E + +    +  ADGGS  K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKV-SFKTKLEAADGGSKIKVSVT 118
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            FHTKGDA +P+E  +    ++  +FKAIE Y+++N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 118. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 76.3 bits 314,  Expect = 4e-16
 Identities = 50/146 34%, Positives = 88/146 60%, Gaps = 1/146 0%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
            + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 76.1 bits 313,  Expect = 5e-16
 Identities = 53/145 36%, Positives = 89/145 61%, Gaps = 2/145 1%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
            + TS V+   +++ +  D D +IPKA  G+++SV+ V+G+GG GT++ I++ E      +
Sbjct  9    QATSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + ++V++  L Y  +++ G  L +  E I     +   ADGGS+ K T  +H KGDA 
Sbjct  68   LHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISYHGKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ ALFKA+EAYL+AN
Sbjct  128  PNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 74.7 bits 306,  Expect = 1e-15
 Identities = 54/134 40%, Positives = 80/134 59%, Gaps = 2/134 1%
Query  11   TSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTV 69
            TS +   K+F   VLD D +IPK AP A KSV++ +GDGG GTV+ I L EG+  + +  
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  70   RTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVP 129
            + D ++K  + Y  ++ +GD L + IE I   + +V +  G SI KTT+ +H KG A + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIK 120
Query  130  EENIKFADAQNTALFK 145
            EE +K    +   LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 121. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 73.9 bits 303,  Expect = 2e-15
 Identities = 57/153 37%, Positives = 89/153 58%, Gaps = 2/153 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +   EI S V+   ++  +V D D VIPKA   ++KSV+ V+G+GG GT++ IT+ 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++  L Y  +V+ G  L +  E I     +V   +GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            + TKGDA   ++ +K   A+  ALFKAIEAYL+A+
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAH 154

Sequence Alignment: 122. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 73.4 bits 301,  Expect = 4e-15
 Identities = 48/145 33%, Positives = 83/145 57%, Gaps = 1/145 0%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +++ E T+++S  ++F  +VLD D ++PK      K+ + ++GDGG G+++ + + 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            EG PI  +  +   ++ + L    ++I+GDIL E +ESI   +      +GG + KTT  
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  FHTKGDAVVPEENIKFADAQNTALFK 145
            +HTKGD VV EE       +N   F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 123. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 73.0 bits 299,  Expect = 4e-15
 Identities = 50/145 34%, Positives = 87/145 60%, Gaps = 2/145 1%
Query  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
            + TS V+   ++  +V D DT++PKA   ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  9    QTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
Query  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
              + + +++  L Y  +++ G  L +  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   LHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAP 127
Query  128  VPEENIKFADAQNTALFKAIEAYLIAN 154
              E+ +K   A++ ALFK IEAYL+AN
Sbjct  128  PNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 124. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 70.9 bits 289,  Expect = 2e-14
 Identities = 54/152 35%, Positives = 87/152 57%, Gaps = 3/152 1%
Query  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
            MG  +   EITS+V   K+++ +  D D++ PK      KSV+ V+G+GG GT++ +T+ 
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
Query  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
            E      +  + +++++    Y+ +V+ G  L    E I     +V   +GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154
            +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 43.4 bits 161,  Expect = 2e-06
 Identities = 30/73 41%, Positives = 44/73 60%, Gaps = 4/73 5%
Query  77   EALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK 134
            E   Y    ++GD L + +E I  ET +V  P++   +I KTT+ +HTKGD  + EE++K
Sbjct  18   EGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSS--STIIKTTSKYHTKGDVEIKEEHVK 75
Query  135  FADAQNTALFKAIEAYL 151
                +   LFK IE YL
Sbjct  76   AGKEKAAHLFKLIEGYL 92

Sequence Alignment: 126. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 35.5 bits 126,  Expect = 0.0008
 Identities = 35/136 25%, Positives = 64/136 47%, Gaps = 6/136 4%
Query  13   SVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIIT-LPEGSPITSMTVR 70
            SV  E +++ +  D  TV+PK  P   K V  ++GDGG GT+ I   LPE SP +     
Sbjct  12   SVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP-SYQREE 70
Query  71   TDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPE 130
                ++ +      VI+G  L + +   +T   +    +  ++      +    D  + E
Sbjct  71   ITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSD--IEE 128
Query  131  ENIKFADAQNTALF-KAIEAYL 151
            +      +Q+T ++ + +E YL
Sbjct  129  KVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 127. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 32.2 bits 107,  Expect = 0.003
 Identities = 17/48 35%, Positives = 29/48 60%, Gaps = 1/48 2%
Query  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGG 49
            G  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.