The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A2L1DGQ3 Art ar 2.0101 163 1179 275.9 3.9e-76
AVD29826 Art la 2.0101 163 1171 274.0 1.4e-75
AVD29825 Art gm 2.0101 163 1169 273.6 1.9e-75
AVD29824 Art ca 2.0101 163 1162 272.0 5.8e-75
AVD29827 Art si 2.0101 163 1162 272.0 5.8e-75
AVD29822 Art an 2.0101 163 1161 271.8 6.8e-75
XP_007199020 Pru p 9.0101 161 404 99.2 5.9e-23
AAU15051 Cyn d 24.0101 153 399 98.1 1.2e-22
P35782 Vesp c 5 202 234 60.3 3.7e-11
P35781 Vesp c 5 202 234 60.3 3.7e-11
P81657 Vesp m 5 202 230 59.4 6.9e-11
P81656 Pol d 5 206 225 58.3 1.6e-10
P0DMB9 Vesp v 5.0101 202 222 57.6 2.5e-10
P83377 Pol g 5 206 220 57.1 3.5e-10
P35780 Pol f 5 205 216 56.2 6.5e-10
Q05109 Pol a 5 209 208 54.4 2.3e-09
P86686 Poly p 5.0102 207 203 53.3 5.1e-09
P35779 Sol r 3 211 201 52.8 7.2e-09
P35760 Ves m 5 204 200 52.6 8e-09
AAY32926 Sol g 3.0101 70 187 51.0 8.1e-09
C0HJV9 Poly p 5.0101 206 200 52.6 8.1e-09
P35784 Ves g 5 204 199 52.4 9.4e-09
Q7Z156 Poly s 5.0101 207 199 52.3 9.6e-09
P35759 Pol e 5.0101 205 198 52.1 1.1e-08
Q7M1G9 Art v 2.0101 71 185 50.5 1.2e-08
P35785 Ves p 5 204 197 51.9 1.3e-08
P35778 Sol i 3 234 197 51.8 1.5e-08
AAT95009 Pol e 5.0101 226 191 50.5 3.8e-08
Q05108 Dol a 5 203 189 50.1 4.5e-08
QEA69430 Sco m 5.0101 210 189 50.1 4.7e-08
Q05110 Ves v 5 227 189 50.0 5.2e-08
P35783 Ves f 5 204 188 49.8 5.3e-08
P10736 Dol m 5.0101 227 186 49.3 8.4e-08
P35787 Ves vi 5 206 183 48.7 1.2e-07
P35786 Ves s 5 205 181 48.2 1.6e-07
AAA28302 Dol m 5.02 212 175 46.9 4.4e-07
P10737 Dol m 5.02 215 175 46.9 4.5e-07
C0ITL3 Pac c 3.0101 199 166 44.8 1.7e-06
AAF65314 Cte f 2 264 126 35.6 0.0013
P83834 Cuc m 3.0101 41 84 30.7 0.0061
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 275.9 bits 1179,  Expect = 4e-76
 Identities = 163/163 100%, Positives = 163/163 100%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 2. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 274.0 bits 1171,  Expect = 1e-75
 Identities = 162/163 99%, Positives = 162/163 99%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNISLVLAISFAILH SHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNISLVLAISFAILHSSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 3. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 273.6 bits 1169,  Expect = 2e-75
 Identities = 160/163 98%, Positives = 162/163 99%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAETRTPDCSL+HSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAETRTPDCSLVHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWAN+ERVGCGRALCSNGWAYI VCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANTERVGCGRALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 4. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 272.0 bits 1162,  Expect = 6e-75
 Identities = 161/163 98%, Positives = 161/163 98%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNI LVLAISFAILHLSHAH TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNILLVLAISFAILHLSHAHGTYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 5. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 272.0 bits 1162,  Expect = 6e-75
 Identities = 160/163 98%, Positives = 161/163 98%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAE RT DCSL+HSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAEARTADCSLVHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 6. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 271.8 bits 1161,  Expect = 7e-75
 Identities = 159/163 97%, Positives = 161/163 98%, Gaps = 0/163 0%
Query  1    MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
            MGHLRNISLVLAI FAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA
Sbjct  1    MGHLRNISLVLAILFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELA 60
Query  61   KVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
            KVAQAWAETRTPDCSL+HSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH
Sbjct  61   KVAQAWAETRTPDCSLVHSDRCGENMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
Query  121  YTQIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            YTQIVWAN+ERVGCGRALCSNGWAYI VCNYDPPGNVVGQKPY
Sbjct  121  YTQIVWANTERVGCGRALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 7. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 99.2 bits 404,  Expect = 6e-23
 Identities = 63/155 40%, Positives = 92/155 59%, Gaps = 6/155 3%
Query  6    NISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQA 65
            N  L+LAI    L ++       +     D +V  HN  R+ +G KPL W+  LA+ AQ 
Sbjct  4    NTKLLLAICCVALVFTLVSANISK--EEIDGFVEEHNKARKEVGNKPLKWNTTLAQYAQE 61
Query  66   WAETRTPDCSLIHS-DRCGENMAQG-AINGSMAVQLWLDERLDYDYNENKCIK-MCGHYT 122
            +A+ R  DC++ HS  R GEN+A G  ++G+ A + W+ E+  YD   NKC+K  CGHY 
Sbjct  62   YADKRVGDCAMEHSMGRWGENLASGDGMSGAAATKYWVTEKEFYDEKSNKCVKDECGHYL 121
Query  123  QIVWANSERVGCGRALCSNGWAYIIVCNYDPPGNVVGQKPY 163
             +VW  +  VGCG + C+NG  Y+ VC+YDP      ++PY
Sbjct  122  AVVWGKTTEVGCGISKCNNGQNYV-VCSYDPMYQPEDERPY 161

Sequence Alignment: 8. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 98.1 bits 399,  Expect = 1e-22
 Identities = 59/128 46%, Positives = 79/128 61%, Gaps = 6/128 4%
Query  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAI 91
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC ++HSD   GEN+    GAI
Sbjct  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
Query  92   NGSMAVQLWLDERLDYDYNENKCI--KMCGHYTQIVWANSERVGCGRALCSNGWAYIIVC 149
            +    V  W DE+  Y Y  N C   KMCGHYT +VW ++  VGCGR LC +    +I+C
Sbjct  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
Query  150  NYDPPGNVVGQKPY 163
            +Y PPGN   QKPY
Sbjct  140  SYWPPGNYENQKPY 153

Sequence Alignment: 9. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 60.3 bits 234,  Expect = 4e-11
 Identities = 60/120 50%, Positives = 81/120 67%, Gaps = 36/120 30%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P               M  L W+DELA++AQ WA      C+  H D C  
Sbjct  60   ETRGNPGPQPP-----------AKSMNTLVWNDELAQIAQVWAN----QCNYGH-DNCRN 103
Query  83   ------GENMAQGA------INGSMAVQLWLDERLDYDYN--ENKCIKMCGHYTQIVWAN 128
                  G+N+A+G+      +N S  V++W DE  DY Y   +NK  K+ GHYTQ+VWA 
Sbjct  104  SAKYSVGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKLNKV-GHYTQMVWAK 162
Query  129  SERVGCGRA-LCSNGWA-YIIVCNYDPPGNVVGQKP 162
            ++ +GCG      +GW  + +VCNY P GNV G +P
Sbjct  163  TKEIGCGSEDYIEDGWHRHYLVCNYGPAGNV-GNEP 197

Sequence Alignment: 10. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 60.3 bits 234,  Expect = 4e-11
 Identities = 61/120 50%, Positives = 82/120 68%, Gaps = 36/120 30%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P               M  L W+DELA++AQ WA      C+  H D C  
Sbjct  60   ETRGNPGPQPP-----------AKSMNTLVWNDELAQIAQVWAN----QCNYGH-DNCRN 103
Query  83   ------GENMAQGAIN----GSMA--VQLWLDERLDYDYN--ENKCIKMCGHYTQIVWAN 128
                  G+N+A+G+      GS++  V++W DE  DY Y   +NK  K+ GHYTQ+VWA 
Sbjct  104  SAKYSVGQNIAEGSTTADNFGSVSNMVKMWEDEVKDYQYGSPKNKLNKV-GHYTQMVWAK 162
Query  129  SERVGCGRA-LCSNGWA-YIIVCNYDPPGNVVGQKP 162
            ++ +GCG      NGW  + +VCNY P GNV G +P
Sbjct  163  TKEIGCGSIKYIENGWHRHYLVCNYGPAGNV-GNEP 197

Sequence Alignment: 11. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 59.4 bits 230,  Expect = 7e-11
 Identities = 60/120 50%, Positives = 81/120 67%, Gaps = 36/120 30%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G+PG  P               M  L W+DELA++AQ WA      C   H D C  
Sbjct  60   ETRGKPGPQPP-----------AKSMNTLVWNDELAQIAQVWA----GQCDYGH-DVCRN 103
Query  83   ------GENMAQ-GAINGSMA-----VQLWLDERLDYDYN--ENKCIKMCGHYTQIVWAN 128
                  G+N+A+ G+   S A     VQ+W DE  +Y Y   +NK I++ GHYTQ+VWA 
Sbjct  104  TAKYSVGQNIAENGSTAASFASVSNMVQMWADEVKNYQYGSTKNKLIEV-GHYTQMVWAK 162
Query  129  SERVGCGRA-LCSNGWA-YIIVCNYDPPGNVVGQKP 162
            ++ +GCG      NGW  + +VCNY P GN+ G +P
Sbjct  163  TKEIGCGSIKYIENGWHRHYLVCNYGPAGNI-GNEP 197

Sequence Alignment: 12. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 58.3 bits 225,  Expect = 2e-10
 Identities = 59/124 47%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C  
Sbjct  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRN 106
Query  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203

Sequence Alignment: 13. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 57.6 bits 222,  Expect = 2e-10
 Identities = 56/121 46%, Positives = 75/121 61%, Gaps = 34/121 28%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P               M  L W+DELA++AQ WA      C   H D C  
Sbjct  60   ETRGNPGPQPP-----------AKSMNTLVWNDELAQIAQVWAS----QCKYGH-DNCRN 103
Query  83   ------GENMAQGAING------SMAVQLWLDERLDYDYNENKC-IKMCGHYTQIVWANS 129
                  G+N+A+ +         S  V++W DE  DY Y  +K  +   GHYTQ+VWA +
Sbjct  104  TAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSKNKLNDVGHYTQMVWAKT 163
Query  130  ERVGCGRA-LCSNGWAY-IIVCNYDPPGNVVGQKP 162
            + +GCG      NGW +  +VCNY P GN+ G +P
Sbjct  164  KEIGCGNIKYIENGWHHHYLVCNYGPAGNI-GNEP 197

Sequence Alignment: 14. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 57.1 bits 220,  Expect = 3e-10
 Identities = 58/124 46%, Positives = 80/124 64%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DE AK+AQ WA      C ++  D+C  
Sbjct  62   ETRGNPGPQPA----ASN-------MNNLVWNDEQAKIAQVWAS----QCQILVHDKCRN 106
Query  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  167  TKEVGCGSLKYVEKNMKIHYLICNYGPAGNYLGQPIY 203

Sequence Alignment: 15. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 56.2 bits 216,  Expect = 6e-10
 Identities = 51/123 41%, Positives = 80/123 65%, Gaps = 34/123 27%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWAS----QCQILVHDKC-R 105
Query  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202

Sequence Alignment: 16. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 54.4 bits 208,  Expect = 2e-09
 Identities = 54/124 43%, Positives = 78/124 62%, Gaps = 32/124 25%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  66   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKCRN 110
Query  83   ------GENMAQ-GAINGSMAV---QLWLDERLDYDYNEN---KCIKMCGHYTQIVWANS 129
                  G+N+A  G  N    V   +LW +E  D++YN     +     GHYTQ+VW  +
Sbjct  111  TAKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKT 170
Query  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            + +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  171  KEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206

Sequence Alignment: 17. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 53.3 bits 203,  Expect = 5e-09
 Identities = 53/124 42%, Positives = 76/124 61%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A +       M  L W+DELA +AQ WA      C +   D+C  
Sbjct  63   ETRGNPGPQPA----ASD-------MNNLVWNDELAYIAQVWAS----QCQFFVHDKCRN 107
Query  83   ------GENMAQGAINGSMA-----VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
                  G+N+A  A   +       + LW +E  D++YN     +     GHYTQ+VWA 
Sbjct  108  TAQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAK 167
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG  + +     ++ +VCNY P GNV+G + Y
Sbjct  168  TKEVGCGSIKYIEKGMKSHYLVCNYGPAGNVLGAQIY 204

Sequence Alignment: 18. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 52.8 bits 201,  Expect = 7e-09
 Identities = 51/109 46%, Positives = 73/109 66%, Gaps = 28/109 25%
Query  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC--------GENMAQGAING------SM 95
            M  L WD ELA +AQ WA      C++ H D C        G+N+A  + +G      S 
Sbjct  76   MPNLTWDPELATIAQRWAN----QCTFEH-DACRNVERFAVGQNIAATSSSGKNKSTLSD 130
Query  96   AVQLWLDERLDYD------YNENKCIKM-CGHYTQIVWANSERVGCGRALCS-NGWA-YI 146
             + LW +E  D+D      +  +  I M  GHYTQIVWA ++++GCGR +   + W  + 
Sbjct  131  MILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHY 190
Query  147  IVCNYDPPGNVVGQKPY 163
            +VCNY P GNV+G + Y
Sbjct  191  LVCNYGPAGNVLGAQIY 207

Sequence Alignment: 19. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 52.6 bits 200,  Expect = 8e-09
 Identities = 58/124 46%, Positives = 79/124 63%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
            ET G PG  P     A N       MK L W DELA +AQ WA   +     C  +   +
Sbjct  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQ 108
Query  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
             G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ+VWAN
Sbjct  109  VGQNVA---LTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQMVWAN 164
Query  129  SERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG        W  + +VCNY P GN   ++ Y
Sbjct  165  TKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201

Sequence Alignment: 20. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 51.0 bits 187,  Expect = 8e-09
 Identities = 28/60 46%, Positives = 41/60 68%, Gaps = 7/60 11%
Query  100  WLDERLDYDYNENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA-YIIVCNYDPPGN 156
            W+     +  + N  +K+ GHYTQIVWA + ++GCGR +    + W  + +VCNY P GN
Sbjct  4    WIS---SFPSDPNILMKI-GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 59
Query  157  VVGQKPY 163
            V+G K Y
Sbjct  60   VLGAKIY 66

Sequence Alignment: 21. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 52.6 bits 200,  Expect = 8e-09
 Identities = 52/124 41%, Positives = 76/124 61%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A +       M  L W+DELA +AQ WA      C +   D+C  
Sbjct  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAYIAQVWAS----QCQFFVHDKCRN 106
Query  83   ------GENMAQGAINGSMA-----VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
                  G+N+A  A   +       + LW +E  D++Y++    +     GHYTQ+VWA 
Sbjct  107  TAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAK 166
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG  + +     ++ +VCNY P GN +GQ  Y
Sbjct  167  TKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 203

Sequence Alignment: 22. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 52.4 bits 199,  Expect = 9e-09
 Identities = 61/119 51%, Positives = 80/119 67%, Gaps = 43/119 36%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       MK L W DELA +AQ WA      C   H D C  
Sbjct  60   ETRGNPGPQPP----AKN-------MKNLVWSDELAYIAQVWAN----QCQYGH-DTCRD 103
Query  83   ------GENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQ 123
                  G+N+A   + GS A         V++W DE  DY+    ++EN  +K+ GHYTQ
Sbjct  104  VAKYPVGQNVA---LTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKI-GHYTQ 159
Query  124  IVWANSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            +VWAN++ VGCG      + W  + +VCNY P GN   ++ Y
Sbjct  160  MVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNFGNEELY 201

Sequence Alignment: 23. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 52.3 bits 199,  Expect = 1e-08
 Identities = 52/124 41%, Positives = 76/124 61%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A +       M  L W+DELA +AQ WA      C +   D+C  
Sbjct  63   ETRGNPGPQPA----ASD-------MNNLVWNDELAYIAQVWAN----QCQFFVHDKCRN 107
Query  83   ------GENMAQGAINGSMA-----VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
                  G+N+A  A   +       + LW +E  D++Y++    +     GHYTQ+VWA 
Sbjct  108  TAQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAK 167
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG  + +     ++ +VCNY P GN +GQ  Y
Sbjct  168  TKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 204

Sequence Alignment: 24. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 52.1 bits 198,  Expect = 1e-08
 Identities = 50/123 40%, Positives = 77/123 62%, Gaps = 34/123 27%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  62   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 105
Query  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  106  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 165
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            ++ +GCG  + + +    + ++CNY P GN +GQ PY
Sbjct  166  TKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202

Sequence Alignment: 25. Allergen Name: Art v 2.0101 Sequence ID: Q7M1G9

 Score = 50.5 bits 185,  Expect = 1e-08
 Identities = 49/63 77%, Positives = 51/63 80%, Gaps = 33/63 52%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
            ETYGEPGNTPDDYVHAHN IRRVLGM P                                
Sbjct  2    ETYGEPGNTPDDYVHAHNNIRRVLGMXP-------------------------------- 29
Query  85   NMAQGAINGSMAVQLWLDERLDYDYNENKCIKMCGH 120
               QGAI+GS  VQL LDE LDYDYN NK IK  G+
Sbjct  30   -KXQGAIDGSSXVQLXLDEXLDYDYNXNKXIKPPGN 64

Sequence Alignment: 26. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 51.9 bits 197,  Expect = 1e-08
 Identities = 62/119 52%, Positives = 80/119 67%, Gaps = 43/119 36%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       MK L W+DELA VAQ WA      C   H D C  
Sbjct  60   ETRGNPGPQPP----AKN-------MKNLVWNDELAYVAQVWAN----QCQYGH-DTCRD 103
Query  83   ------GENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQ 123
                  G+N+A   + GS A         V++W DE  DY+    ++EN   K+ GHYTQ
Sbjct  104  VAKYPVGQNVA---LTGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKI-GHYTQ 159
Query  124  IVWANSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            +VWAN++ +GCG      N W  + +VCNY P GN   ++ Y
Sbjct  160  MVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFGNEELY 201

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 51.8 bits 197,  Expect = 2e-08
 Identities = 50/108 46%, Positives = 73/108 67%, Gaps = 31/108 28%
Query  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC--------GENMAQGAING------SM 95
            M  L WD ELA +AQ WA      C++ H D C        G+N+A  + +G      + 
Sbjct  98   MPNLTWDPELATIAQRWAN----QCTFEH-DACRNVERFAVGQNIAATSSSGKNKSTPNE 152
Query  96   AVQLWLDERLDYDY--------NENKCIKMCGHYTQIVWANSERVGCGRALCS--NGWA- 144
             + LW +E  D+D         ++N  +K+ GHYTQIVWA + ++GCGR +    + W  
Sbjct  153  MILLWYNEVKDFDNRWISSFPSDDNILMKV-GHYTQIVWAKTTKIGCGRIMFKEPDNWTK 211
Query  145  YIIVCNYDPPGNVVGQKPY 163
            + +VCNY P GNV+G   Y
Sbjct  212  HYLVCNYGPAGNVLGAPIY 230

Sequence Alignment: 28. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 50.5 bits 191,  Expect = 4e-08
 Identities = 49/122 40%, Positives = 76/122 62%, Gaps = 34/122 27%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  83   ETRGNPGPQPA----ASD-------MNDLVWNDELAHIAQVWAS----QCQFLVHDKC-R 126
Query  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWAN 128
            N A+  +  ++A             ++LW +E  D++YN     +     GHYTQ+VW  
Sbjct  127  NTAKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGK 186
Query  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKP 162
            ++ +GCG  + + +    + ++CNY P GN +GQ P
Sbjct  187  TKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222

Sequence Alignment: 29. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 50.1 bits 189,  Expect = 5e-08
 Identities = 58/122 47%, Positives = 77/122 63%, Gaps = 37/122 30%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C++ H D+C  
Sbjct  59   ETRGNPGPQPP----AKN-------MNLLVWNDELAKIAQTWAN----QCNFGH-DQCRN 102
Query  83   ------GENMAQGAING------SMAVQLWLDERLDY----DYNENKCIKMCGHYTQIVW 126
                  G+N+A  +  G      S  +++W DE  DY    D   N   K+ GHYTQ+VW
Sbjct  103  TAKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKV-GHYTQMVW 161
Query  127  ANSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
              ++ +GCG      N W  + +VCNY P GN + Q  Y
Sbjct  162  GKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYMNQPVY 200

Sequence Alignment: 30. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 50.1 bits 189,  Expect = 5e-08
 Identities = 48/109 44%, Positives = 63/109 57%, Gaps = 21/109 19%
Query  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC----------GENMAQGAINGSM--AV 97
            MK L WDD++A  AQ  AET    C + H+ +           GEN+  G+    +  +V
Sbjct  64   MKELHWDDQIAANAQRSAET----CVFQHTAKNLRKTSKYSYLGENIYMGSYPDPIPRSV 119
Query  98   QLWLDERLDYDYNENKCIK----MCGHYTQIVWANSERVGCGRALCSNGWAYIIVCNYDP 153
              W DE  D      K  +    M GHYTQ+VWAN+E +GCG    S+   YI  C Y P
Sbjct  120  NAWYDEVKDVTPAVVKSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKNTYIF-CQYGP 178
Query  154  PGNVVGQKPY 163
             GN  G+  Y
Sbjct  179  SGNYPGEPIY 188

Sequence Alignment: 31. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 50.0 bits 189,  Expect = 5e-08
 Identities = 58/124 46%, Positives = 79/124 63%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
            ET G PG  P     A N       MK L W+DELA VAQ WA   +     C  +   +
Sbjct  83   ETRGNPGPQPP----AKN-------MKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQ 131
Query  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
             G+N+A   + GS A         V++W DE  DY+    ++ N  +K  GHYTQ+VWAN
Sbjct  132  VGQNVA---LTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKT-GHYTQMVWAN 187
Query  129  SERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG        W  + +VCNY P GN + ++ Y
Sbjct  188  TKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELY 224

Sequence Alignment: 32. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 49.8 bits 188,  Expect = 5e-08
 Identities = 59/124 47%, Positives = 79/124 63%, Gaps = 33/124 26%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
            ET G PG  P     A N       MK L W+DELA VAQ WA   +     C  I   +
Sbjct  60   ETRGNPGPQPP----AKN-------MKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQ 108
Query  82   CGENMAQGAINGSMA---------VQLWLDERLDYD----YNENKCIKMCGHYTQIVWAN 128
             G+N+A   + GS A         V++W DE  DY+    ++ N  +K  GHYTQ+VWAN
Sbjct  109  VGQNVA---LTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKT-GHYTQMVWAN 164
Query  129  SERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            ++ VGCG   +    W  + +VCNY P GN   ++ Y
Sbjct  165  TKEVGCGSIKFIQEKWHKHYLVCNYGPSGNFQNEELY 201

Sequence Alignment: 33. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 49.3 bits 186,  Expect = 8e-08
 Identities = 51/128 39%, Positives = 75/128 58%, Gaps = 25/128 19%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSDR 81
            ET G+PG  P     A N       M  L W+DELAK+AQ WA   +    DC      +
Sbjct  83   ETRGKPGPQPP----AKN-------MNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQ 131
Query  82   CGENMAQGAING------SMAVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWANSERV 132
             G+N+A  +         S  ++ W DE  +++Y    +N   +  GHYTQ+VW  ++ +
Sbjct  132  VGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEI 191
Query  133  GCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163
            GCG  + +  N + + +VCNY P GN   Q  Y
Sbjct  192  GCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224

Sequence Alignment: 34. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 48.7 bits 183,  Expect = 1e-07
 Identities = 53/123 43%, Positives = 76/123 61%, Gaps = 35/123 28%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C  
Sbjct  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKD 105
Query  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
Query  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
             ++ +GCG      + W  + +VCNY P GN   +K Y
Sbjct  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203

Sequence Alignment: 35. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 48.2 bits 181,  Expect = 2e-07
 Identities = 55/123 44%, Positives = 73/123 59%, Gaps = 35/123 28%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
            ET G PG  P     A N       M  L W++ELA +AQ WA      C   H D C +
Sbjct  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKD 104
Query  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
Query  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
             ++ +GCG      N W  + +VCNY P GN   Q+ Y
Sbjct  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202

Sequence Alignment: 36. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 46.9 bits 175,  Expect = 4e-07
 Identities = 56/122 45%, Positives = 78/122 63%, Gaps = 38/122 31%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DELAK+AQ WA      CS+ H D+C  
Sbjct  70   ETRGNPGPQPP----AKN-------MNVLVWNDELAKIAQTWAN----QCSFGH-DQCRN 113
Query  83   ------GENMAQGAING------SMAVQLWLDERLDYD-----YNENKCIKMCGHYTQIV 125
                  G+N+A  +  G      S  +++W +E  D++       +N   K+ GHYTQ+V
Sbjct  114  TEKYQVGQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKV-GHYTQMV 172
Query  126  WANSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            W  ++ +GCG      N W  + +VCNY P GN + Q  Y
Sbjct  173  WGKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 37. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 46.9 bits 175,  Expect = 4e-07
 Identities = 56/122 45%, Positives = 78/122 63%, Gaps = 38/122 31%
Query  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
            ET G PG  P     A N       M  L W+DELAK+AQ WA      CS+ H D+C  
Sbjct  70   ETRGNPGPQPP----AKN-------MNVLVWNDELAKIAQTWAN----QCSFGH-DQCRN 113
Query  83   ------GENMAQGAING------SMAVQLWLDERLDYD-----YNENKCIKMCGHYTQIV 125
                  G+N+A  +  G      S  +++W +E  D++       +N   K+ GHYTQ+V
Sbjct  114  TEKYQVGQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKV-GHYTQMV 172
Query  126  WANSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163
            W  ++ +GCG      N W  + +VCNY P GN + Q  Y
Sbjct  173  WGKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 38. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 44.8 bits 166,  Expect = 2e-06
 Identities = 51/128 39%, Positives = 74/128 57%, Gaps = 31/128 24%
Query  24   HETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWA---ETRTPDCSLIHSD 80
            +ET G PG  P     A N       M  L WD+ELA +AQ W    +     C  +   
Sbjct  52   QETRGNPGPQPA----ASN-------MPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERY 100
Query  81   RCGENMA------QGAINGSMAVQLWLDERLDYDYNE--------NKCIKMCGHYTQIVW 126
            + G+N+A      +G  N +  VQ+W++E    +  +        N  +K+ GHYTQ+VW
Sbjct  101  QVGQNIAMSGSTAKGPCNMNNLVQMWINEVNALNAADVSSMPSDGNYFMKI-GHYTQLVW 159
Query  127  ANSERVGCGRALCSNGWAY--IIVCNYDPPGNVVGQKPY 163
              + +VGCG     +G  Y   + CNY P GN+ G   Y
Sbjct  160  GKTTKVGCGIIQFLDGKFYKCYLACNYGPAGNMFGAPIY 198

Sequence Alignment: 39. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 35.6 bits 126,  Expect = 0.001
 Identities = 39/112 34%, Positives = 61/112 54%, Gaps = 27/112 24%
Query  50   MKPLCWDDELAKVAQ---AWAETRTPDCSLIHSDRCGENM---------AQGAINGSMAV 97
            M  L W+  LAK+A+      E +  DC+       G+N+          + +    MAV
Sbjct  102  MPNLTWNIALAKLAEYNVKQCEMKH-DCAKTRHGHTGQNLFFYGTTLSPIKNSTIAKMAV 160
Query  98   QLWLDERLDYDYNENKCI-------KMCGHYTQIVWANSERVGCGRALC---SNGWAY-- 145
              W  E  D    + K +       K  GHYTQ++W N+ +VGC  +     SNG  +  
Sbjct  161  DGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVGCAVSTYKKHSNGNMFNM 220
Query  146  -IIVCNYDPPGNVVGQKPY 163
             ++ CNY   GN++ +  Y
Sbjct  221  TLVACNYRG-GNMLEEAVY 238

Sequence Alignment: 40. Allergen Name: Cuc m 3.0101 Sequence ID: P83834

 Score = 30.7 bits 84,  Expect = 0.006
 Identities = 15/38 39%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHS 79
            D+V AHN  R  +G+ P+ W         A+A     D +L+HS
Sbjct  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.