The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKY
YKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQ
ERYKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQK
SKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGD
IVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILE
AALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDP
SQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE
IACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNI
RYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAM73730 Ana o 1.0101 538 3625 509.7 1.7e-145
AAM73729 Ana o 1.0102 536 3609 507.5 8e-145
EF116865 Pis v 3.0101 519 2845 402.6 2.8e-113
AAL86739 Cor a 11 448 1622 234.8 8.2e-63
AAK15089 Ses i 3 585 1602 232.0 7.4e-62
A0A2I4E5L6 Jug r 6.0101 502 1302 190.8 1.6e-49
Q9SPL4 Mac i 1.0201 666 1081 160.5 2.9e-40
Q9SPL3 Mac i 1.0101 625 1069 158.8 8.5e-40
AAF18269 Jug r 2 593 932 140.0 3.7e-34
B3STU4 Car i 2.0101 792 933 140.1 4.6e-34
AAM54366 Jug n 2 481 879 132.8 4.5e-32
P09799 Gos h 2 605 870 131.5 1.4e-31
P09801 Gos h 1 588 860 130.1 3.4e-31
V9VGU0 Pin k 2.0101 463 672 104.4 1.5e-23
AAB23463 Gly m conglycinin 439 663 103.2 3.4e-23
O22120 Gly m 5.0101 543 462 75.5 8.7e-15
ACB05815 Lup an 1.0101 611 463 75.6 9e-15
CAA35691 Gly m conglycinin 605 461 75.4 1.1e-14
Q9FZP9 Gly m 5.0201 559 446 73.3 4.1e-14
CAD87731 Len c 1.0102 415 417 69.4 4.6e-13
CAF25232 Pis s 1.0101 415 414 69.0 6.2e-13
CAF25233 Pis s 1.0102 415 410 68.4 9e-13
CAD87730 Len c 1.0101 418 407 68.0 1.2e-12
Q198W3 Vig r 2.0101 453 403 67.5 1.9e-12
P43237 Ara h 1 614 405 67.7 2.3e-12
P43238 Ara h 1 626 378 64.0 3e-11
B1NPN8 Vig r 2.0201 454 348 59.9 3.6e-10
AAB01374 Gly m conglycinin 639 345 59.4 7.1e-10
AAA33947 Gly m conglycinin 218 318 55.9 2.7e-09
DQ631677 Pis v 2.0201 472 182 37.1 0.0027
A5HIX6 Fag e 3.0101 136 160 34.4 0.0054
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 509.7 bits 3625,  Expect = 2e-145
 Identities = 538/538 100%, Positives = 538/538 100%, Gaps = 0/538 0%
Query  1    MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKY 60
            MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKY
Sbjct  1    MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKY 60
Query  61   YKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQ 120
            YKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQ
Sbjct  61   YKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQ 120
Query  121  ERYKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQK 180
            ERYKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQK
Sbjct  121  ERYKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQK 180
Query  181  SKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGD 240
            SKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGD
Sbjct  181  SKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGD 240
Query  241  IVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILE 300
            IVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILE
Sbjct  241  IVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILE 300
Query  301  AALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDP 360
            AALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDP
Sbjct  301  AALKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDP 360
Query  361  SQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE 420
            SQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE
Sbjct  361  SQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE 420
Query  421  IACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNI 480
            IACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNI
Sbjct  421  IACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNI 480
Query  481  RYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE 538
            RYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE
Sbjct  481  RYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE 538

Sequence Alignment: 2. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 507.5 bits 3609,  Expect = 8e-145
 Identities = 535/536 99%, Positives = 536/536 100%, Gaps = 0/536 0%
Query  3    PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYK 62
            PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYK
Sbjct  1    PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYK 60
Query  63   EKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQER 122
            EKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQER
Sbjct  61   EKKGREREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQER 120
Query  123  YKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSK 182
            YKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSK
Sbjct  121  YKKERGQHNYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSK 180
Query  183  LLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIV 242
            LLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIV
Sbjct  181  LLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIV 240
Query  243  SISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAA 302
            SISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAA
Sbjct  241  SISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAA 300
Query  303  LKTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ 362
            LKTSKDTLEKLFEKQDQGTIMKASKEQ+RAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ
Sbjct  301  LKTSKDTLEKLFEKQDQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ 360
Query  363  SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIA 422
            SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIA
Sbjct  361  SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIA 420
Query  423  CPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRY 482
            CPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRY
Sbjct  421  CPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRY 480
Query  483  TLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE 538
            TLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE
Sbjct  481  TLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE 536

Sequence Alignment: 3. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 402.6 bits 2845,  Expect = 3e-113
 Identities = 420/511 82%, Positives = 471/511 92%, Gaps = 9/511 1%
Query  27   KIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTG-GV-D 84
            K DPELKQCKHQCKVQRQYDE+QKEQC K CEKYYKEKKGRE+E EEEEEEWG+G G  D
Sbjct  1    KTDPELKQCKHQCKVQRQYDEEQKEQCAKGCEKYYKEKKGREQE-EEEEEEWGSGRGRGD 59
Query  85   EPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDE 144
            E STHEP EK LSQCM+QCERQ+GGQQKQLCRFRCQE+YKKER +H+Y R+++E+E+ DE
Sbjct  60   EFSTHEPGEKRLSQCMKQCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDE 119
Query  145  A-EEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFV 203
              EEEDENPYVFEDE FTT+VKTEQGKVV+LPKFT++SKLL  LEKYRLA LVANPQAFV
Sbjct  120  EQEEEDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFV 179
Query  204  VPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYL 263
            VP+HMDADSIFFVSWGRGTITKI ENKRES+NV+QGDI+ I +GTPFYI N DENEKLY+
Sbjct  180  VPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYI 239
Query  264  VQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIM 323
            V++L+PVNLPGH+EVFHGPGGENPESFYRAFS E+LEAALKT +D LEKLFEKQD+G I+
Sbjct  240  VKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIV 299
Query  324  KASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKL 383
            KASKEQIRAMSRRGEGP IWPFT +STG+F LFKKDPSQSN YGQLFE+E  DYPPL++L
Sbjct  300  KASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQEL 359
Query  384  DMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH-----PSYKK 438
            D++VSY NITKGGMS PFYNSRATKIAIVVSGEG +EIACPHLSSSK+S      PSYKK
Sbjct  360  DIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKK 419
Query  439  LRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEA 498
            L + IR D+VF+VPAGHPF TVASGN+NLEI+CFEVNAEGNIRYTLAGKKNII+VMEKEA
Sbjct  420  LSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEA 479
Query  499  KELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRADE 538
            KELAFK +GEEVDKVFGKQDEEFFFQGP+WR+ ++GRADE
Sbjct  480  KELAFKTKGEEVDKVFGKQDEEFFFQGPKWRQHQQGRADE 519

Sequence Alignment: 4. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 234.8 bits 1622,  Expect = 8e-63
 Identities = 238/436 54%, Positives = 332/436 76%, Gaps = 13/436 2%
Query  91   PAEK-HLSQCMRQC--ERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEE 147
            P E   L +C  +C  ERQ   QQ++  +  C+E+  +ER Q     E+    +E   +E
Sbjct  3    PKEDPELKKCKHKCRDERQFDEQQRRDGKQICEEK-ARERQQ-----EEGNSSEESYGKE 56
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            ++ENPYVF+DE F ++VKTE+G+V +L  FT++S+LL  +E +RLA+L ANP+ F+ P+H
Sbjct  57   QEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAH 116
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DA+ ++FV+ GR TIT + E KRES NV +GDI+ I +GTP Y+ N DENEKL++V+ L
Sbjct  117  FDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKIL 176
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASK 327
            +PV+ PGHFE F+G GGE+PESFYRAFSWE+LEAALK  ++ LEK+F +Q +G+I+KAS+
Sbjct  177  QPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASR 236
Query  328  EQIRAMSRRGEGP-KIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMV 386
            E+IRA+S+  EGP +IWPF  ES+G   L+ K PSQSN++G+L+EA   D+  L+ LD++
Sbjct  237  EKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLM 296
Query  387  VSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPSYKKLRARIRKD 446
            VS+ANITKG M+ P+YNSRATKI++VV GEG  E+ACPHLSSS  S   Y+K+ AR+R+ 
Sbjct  297  VSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGS---YQKISARLRRG 353
Query  447  TVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAFKME 506
             VF+ PAGHP A +AS N NL+++CFEVNA GN R+ LAGK NI+   E++AKELAF + 
Sbjct  354  VVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLP 413
Query  507  GEEVDKVFGKQDEEFFFQGPEWRKEKEGR 535
              EV+++F  QD+ FFF GP  ++E+ GR
Sbjct  414  SREVERIFKNQDQAFFFPGPNKQQEEGGR 442

Sequence Alignment: 5. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 232.0 bits 1602,  Expect = 7e-62
 Identities = 263/520 50%, Positives = 387/520 74%, Gaps = 62/520 11%
Query  9    FSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEK---- 64
            F+L+L S +V     A    DPELKQCKHQCK Q+Q  ++QKE C++ C++Y ++K    
Sbjct  12   FALLLASAVV-----ASESKDPELKQCKHQCKAQQQISKEQKEACIQACKEYIRQKHQGE 66
Query  65   ---------------------------KGREREHEEEEEE----------WGTGGVDEPS 87
                                       +G E++H E+ EE             G  D+ +
Sbjct  67   HGRGGGDILEEEVWNRKSPIERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDN 126
Query  88   THEPAEKHLSQCMRQCERQ-EGGQ-QKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEA 145
              +P EK+  QC  QC RQ EGG   ++ C  R +E+Y++++G+   + E  E  + +E 
Sbjct  127  PTDP-EKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGREREEE 185
Query  146  EEED---ENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF 202
            +EE      PYVFED+ F T  +T++G++ +L KFT +S+LL  +E YR+A+L A PQ F
Sbjct  186  QEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTF 245
Query  203  VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLY 262
            +VP+H DA+S+ FV+ GRGTI+ + +++RES+N++QGDI+ I++GT  Y+ N D NE+L 
Sbjct  246  IVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLV 305
Query  263  LVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTI 322
            L ++L+PV+ PG FE+F G GGENPESF+++FS EILEAA+ T +D L+++F +Q QG I
Sbjct  306  LAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGVI 365
Query  323  MKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEK 382
            +KAS+EQ+RAMSR  EG  IWPF  ES G+  ++++ P++SN+YGQL E +   Y  L  
Sbjct  366  VKASEEQVRAMSRHEEGG-IWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRD 424
Query  383  LDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH-------PS 435
            LD+ VS ANIT+G M+ P YNS+ATKIA+VV GEG  E+ACPH+S S+ S+       PS
Sbjct  425  LDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPS 484
Query  436  YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVME 495
            Y+++ +R+ + TV I+PAGHPF  VAS N+NL+++CFEVNA  N ++ LAG++N++  +E
Sbjct  485  YQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLE 544
Query  496  KEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRAD 537
            +EAKELAF M   EV++V   Q EEFFF+GP  R++++GRAD
Sbjct  545  REAKELAFGMPAREVEEVSRSQQEEFFFKGP--RQQQQGRAD 584

Sequence Alignment: 6. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 190.8 bits 1302,  Expect = 2e-49
 Identities = 285/475 60%, Positives = 371/475 78%, Gaps = 69/475 14%
Query  11   LFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGRERE 70
            L+L S+L +C G+ALA  DPELKQCKHQC+ QRQ+DEQ+KE+C + C++Y+ EKK RER 
Sbjct  12   LLLTSLLAICAGLALAMQDPELKQCKHQCRHQRQFDEQEKEHCQRSCDEYHIEKKARERA 71
Query  71   HEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQH 130
                                                              ER + E G  
Sbjct  72   --------------------------------------------------ERRRSEEGS- 80
Query  131  NYKREDDEDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKY 190
               RE+  +E+E   E E+ENPYVFEDEDF T+V+T++G++ +L KFT++SKLL  +E +
Sbjct  81   --SREEGYEEEELGGEREEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENF 138
Query  191  RLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPF 250
            R+A+L ANPQ F+ P+H DA+ + FV+ GR TIT + E KRE+ NV QGDI+ I +GTP 
Sbjct  139  RVAILEANPQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPV 198
Query  251  YIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTL 310
            Y+ N DENEKLY+V+ LRPV++PGHFE FHG GGE+PESFYRAFSWE+LEAALKT +D L
Sbjct  199  YLINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQL 258
Query  311  EKLFEKQDQGTIMKASKEQIRAMSRRGEG-PKIWPFTEESTGSFKLFKKDPSQSNKYGQL 369
            EKLF KQ QG I+KASKEQIR+MS+  E  P+IWPF  +ST  F LF K PSQSN++G+L
Sbjct  259  EKLFGKQTQGVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFGRL 318
Query  370  FEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSS 429
            FE +  +   L+ LD++VS+ANITKG M+ P+YNSRATKI++V+ GEG  E+ACPHLSSS
Sbjct  319  FETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSS 378
Query  430  KS---------------SHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 474
             S               S PSY+++R R+R   VF+ PAGHP A +AS N+NL+++CF+V
Sbjct  379  GSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDV 438
Query  475  NAEGNIRYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEG 534
            NA+GNIR+ LAGK NI+   EKEAKELAF     EV+K+F  QD+EFFF GP  + E+ G
Sbjct  439  NAQGNIRFPLAGKNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSRQPEEGG 498
Query  535  RADE 538
            RA E
Sbjct  499  RAFE 502

Sequence Alignment: 7. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 160.5 bits 1081,  Expect = 3e-40
 Identities = 212/504 42%, Positives = 331/504 65%, Gaps = 30/504 5%
Query  29   DPELK--QCKHQCKVQRQYDEQQKEQ-CVKECEKYY-KEKKGREREHEEE----EEEWGT 80
            DP+ +  QC+ +C  QR+  E +  Q C + CE+ Y KEK+ +++ +EE+    EE++  
Sbjct  121  DPQQQYEQCQERC--QRHETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEE 178
Query  81   GGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKE-RGQH--NYKREDD 137
               +E +  +P ++    C R+CE+QE  QQ Q C+ RC+E+ ++  RG    N +R   
Sbjct  179  RMKEEDNKRDPQQREYEDCRRRCEQQEPRQQYQ-CQRRCREQQRQHGRGGDLINPQRGGS 237
Query  138  EDEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVA 197
               +E E E++ +NPY F++  ++T+ +TE+G + +L  F  +SKLL AL+ YRL +L A
Sbjct  238  GRYEEGE-EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEA 296
Query  198  NPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDE 257
            NP AFV+P+H+DAD+I++V+ GRG +  I  + RES N+  GD++ I +GT FY+ N D 
Sbjct  297  NPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDN 356
Query  258  NEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQ 317
            NE+L++ +FL+ ++ PG+++ F   GG+NPE +   FS EILEAAL T  + L  ++ +Q
Sbjct  357  NERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQ 416
Query  318  DQGTIMKASKEQIRAMSRRGEGPKIWPFT---EESTGSFKLFKKDPSQSNKYGQLFEAER 374
             +G I+ AS+EQIR ++R     + W      E S G + LF K P  SNKYGQ +E + 
Sbjct  417  REGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKP 476
Query  375  IDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSS-- 432
             DY  L+ +D+ V  ANIT+G M  PF+N+R+TK+ +V SGE  VE+ACPHLS       
Sbjct  477  EDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRR 536
Query  433  ----HPS-----YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYT 483
                H       Y++++AR+ K    +VP GHP   V+SGNENL +  F +NA+ N    
Sbjct  537  GGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENF 596
Query  484  LAGK-KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 536
            LAG+ +N+++ +E +A ELAF    +EV+++F  QDE  FF GP   +++  R+
Sbjct  597  LAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSSRS 650

Sequence Alignment: 8. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 158.8 bits 1069,  Expect = 8e-40
 Identities = 210/505 41%, Positives = 330/505 65%, Gaps = 28/505 5%
Query  29   DPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYY-KEKKGREREHEE---EEEEWGTGG 82
            DP+ +  QC+ +C+ +R+ + ++ + C + CE+ Y KEK+ +++ +EE   E+EE     
Sbjct  80   DPQQQYEQCQKRCQ-RRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEER 138
Query  83   VDE-PSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKE-RGQH--NYKREDDE 138
            + E  +  +P ++    C R+CE+QE   Q Q C+ RCQE+ ++  RG    N +R    
Sbjct  139  MKEGDNKRDPQQREYEDCRRHCEQQEPRLQYQ-CQRRCQEQQRQHGRGGDLMNPQRGGSG 197
Query  139  DEDEDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVAN 198
              +E E E++ +NPY F++  ++T+ +TE+G + +L  F  +SKLL AL+ YRL +L AN
Sbjct  198  RYEEGE-EKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEAN 256
Query  199  PQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDEN 258
            P AFV+P+H+DAD+I++V  GRG +  I  + RES N+  GD++ I +GT FY+ N D N
Sbjct  257  PNAFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNN 316
Query  259  EKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQD 318
            E+L++ +FL+ ++ PG+++ F   GG+NPE +   FS EILEAAL T  + L  ++ +Q 
Sbjct  317  ERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQR 376
Query  319  QGTIMKASKEQIRAMSRRGEGPKIWPFT---EESTGSFKLFKKDPSQSNKYGQLFEAERI 375
            +G I++AS+EQIR ++R     + W      E S G + LF K P  SNKYGQ +E +  
Sbjct  377  EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPE 436
Query  376  DYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPS 435
            DY  L+ +D+ V  ANIT+G M  PF+N+R+TK+ +V SGE  VE+ACPHLS        
Sbjct  437  DYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGG 496
Query  436  -----------YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTL 484
                       Y+++RAR+ K    +V AGHP   V+SGNENL +  F +NA+ N    L
Sbjct  497  GKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQNNHENFL 556
Query  485  AGK-KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGRA 536
            AG+ +N+++ +E +A ELAF    +EV+++F  QDE  FF GP   +++  R+
Sbjct  557  AGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQSPRS 609

Sequence Alignment: 9. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 140.0 bits 932,  Expect = 4e-34
 Identities = 196/487 40%, Positives = 322/487 66%, Gaps = 41/487 8%
Query  29   DPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEP 86
            DPE +  QC++QC+ QR+  EQ    C + CE+         R++EE E + G       
Sbjct  71   DPEQRYEQCQQQCERQRRGQEQT--LCRRRCEQ--------RRQQEERERQRGR------ 114
Query  87   STHEPAEKHLSQCMRQCERQEGGQQKQ-LCRFRCQERYKKERGQHNYKREDDEDEDEDEA 145
              ++P +++  +C R+C+ QE   ++Q  C+ RC+ +YK+++G+          E     
Sbjct  115  DRQDPQQQY-HRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESRGRE 173
Query  146  EEEDE-NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVV 204
            EE+   NPY F  +   ++ ++E+G+V  L +FT++++LL  +E YR+ +L ANP   ++
Sbjct  174  EEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSML 233
Query  205  PSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLV 264
            P H DA+S+  V+ GR T+T + +  RES N+  GD++ + +G   Y+ N D NE+L +V
Sbjct  234  PHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMV 293
Query  265  QFLRPVNLPGHFEVFHGPGGENPE-SFYRAFSWEILEAALKTSKDTLEKLFEKQDQ--GT 321
            ++L+PVN PG+F  ++  G ++P+ S+ R FS +IL AAL T +D LE++F++Q+Q  G 
Sbjct  294  KLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGV 353
Query  322  IMKASKEQIRAMSRRG--EGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPP 379
            I++AS+E++RA+S+     G + W     S G   L  + PS SN++GQ+FEA   ++  
Sbjct  354  IIRASQEKLRALSQHAMSAGQRPWG-RRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQ 412
Query  380  LEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSS---------- 429
            L+++D++V+YA I +G M VP YNS+AT +  VV G G  E+ACPH+SS           
Sbjct  413  LQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQ 472
Query  430  --KSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGK 487
              + S   ++K+ AR+ +  +F++PAGHP A  AS NENL ++ F++N E N R  LAG+
Sbjct  473  EEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQ 532
Query  488  KNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGR 535
             NII  +E+EAKEL+F M  EE++++F  Q E +F   P  R+ + G+
Sbjct  533  NNIINQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQSRRGQ 578

Sequence Alignment: 10. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 140.1 bits 933,  Expect = 5e-34
 Identities = 198/486 40%, Positives = 327/486 67%, Gaps = 45/486 9%
Query  29   DPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEP 86
            DPE +  QC++QC+ QR+  EQQ   C + CE+        +R++EE E + G       
Sbjct  267  DPEQRYEQCQQQCERQRRGQEQQ--LCRRRCEQ--------QRQQEERERQRGR------ 310
Query  87   STHEPAEKHLSQCMRQCERQEGGQQKQ-LCRFRCQERYKKERGQHNYKREDDEDEDEDEA 145
              ++P +++  +C R+C+ QE   ++Q  C+ RC+ +YK+++G+  +  +      E   
Sbjct  311  DRQDPQQQY-HRCQRRCQTQEQSPERQRQCQQRCERQYKEQQGRE-WGPDQASPRRESRG 368
Query  146  EEEDE---NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF 202
             EE++   NPY F  + + ++ ++ +G+V  L +FT++++LL  +E YR+ +L ANP  F
Sbjct  369  REEEQQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTF 428
Query  203  VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLY 262
            V+P H DA+S+  V+ GR T+T + + +RES N+  GD++ + +G   Y+ N D NE+L 
Sbjct  429  VLPYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLE 488
Query  263  LVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQ--G 320
            +V++L+PVN PG+F  ++  G ++ ES+ R FS +IL AAL T +D LE++F++Q+Q  G
Sbjct  489  MVKLLQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREG 548
Query  321  TIMKASKEQIRAMSRRG--EGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYP 378
             I++AS+E++RA+S+     G + W     S G   L  +  S SN++GQ+FEA   ++ 
Sbjct  549  VIIRASQEKLRALSQHAMSAGQRPWG-RRSSGGPISLKSQRSSYSNQFGQFFEACPEEHR 607
Query  379  PLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKS------- 431
             L+++D++V+YA I +G M VP YNS+AT +  VV G G  E+ACPH  SS+S       
Sbjct  608  QLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRR 667
Query  432  -------SHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTL 484
                   S   ++K+ AR+ +  +F++PAGHP A  AS NENL +V F +N + N R  L
Sbjct  668  EQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFL 727
Query  485  AGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGR 535
            AG+ NII  +E+EAKEL+F M  EE++++F +Q E +F   P  R+ + G+
Sbjct  728  AGQNNIINQLEREAKELSFNMPREEIEEIFERQVESYFV--PMERQSRRGQ 776
 Score = 49.9 bits 276,  Expect = 6e-07
 Identities = 46/112 41%, Positives = 73/112 65%, Gaps = 16/112 14%
Query  29   DP--ELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEP 86
            DP  + +QC+ +C+ Q Q  ++Q++QC   CE+ ++E++   R +EE E   G    DE 
Sbjct  150  DPREQYRQCEEHCRRQGQ-GQRQQQQCQSRCEERFEEEQ---RRQEERERRRGRDNDDEE 205
Query  87   STHEPAEKHLSQCMRQCERQEGGQ-QKQLCRFRCQERYKKE-RGQHNYKREDDEDEDEDE 144
            +  +P E++  QC  +C RQ  GQ Q+Q C+ RC+ER ++E R Q   +R    DED   
Sbjct  206  NPRDPREQY-RQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQEERERRRGRDED--- 261
Query  145  AEEEDENP 152
                D+NP
Sbjct  262  ----DQNP 265

Sequence Alignment: 11. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 132.8 bits 879,  Expect = 4e-32
 Identities = 174/444 39%, Positives = 292/444 65%, Gaps = 21/444 4%
Query  89   HEPAEKHLSQCMRQCERQEGGQQKQ-LCRFRCQERYKKERGQHNYKREDDEDEDEDEAEE 147
            ++P +++  +C R+C+ QE   ++Q  C+ RC+ +YK+++G+          E +   EE
Sbjct  5    QDPQQQY-HRCQRRCQIQEQSPERQRQCQQRCERQYKEQQGRERGPEASPRRESKGREEE 63
Query  148  EDE-NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPS 206
            +   NPY F  +   ++ ++E+G+V  L +F ++++LL  +E YR+ +L ANP  F++P 
Sbjct  64   QQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPH 123
Query  207  HMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQF 266
            H DA+S+  V+ GR T+T + +  RES N+  GD++ + +G   Y+ N D NE+L +V++
Sbjct  124  HKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKL 183
Query  267  LRPVNLPGHFEVFHGPGGENPE-SFYRAFSWEILEAALKTSKDTLEKLFEKQDQ--GTIM 323
            L+PVN PG+   ++  G ++P+ S+ R FS +IL AAL T +D LE++F++Q+Q  G I+
Sbjct  184  LQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVII 243
Query  324  KASKEQIRAMSRRGEGPKIWPFTEESTGS-FKLFKKDPSQSNKYGQLFEAERIDYPPLEK 382
            +AS+E++RA+S+        P+   S+G    L  + PS SN++GQ+FEA   ++  L++
Sbjct  244  RASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQE 303
Query  383  LDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSS------------K 430
            +D++V+YA I +G M VP YNS+AT +  VV G G  E+ACPH+SS             +
Sbjct  304  MDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEE 363
Query  431  SSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNI 490
             S   ++K+ AR+ +  +F++PAGHP A  AS NENL ++ F +N E N R  LAG+ +I
Sbjct  364  ESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQNSI 423
Query  491  IKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKEGR 535
            I  +E+EAKEL+F M  EE++++F  Q E +F   P  R+ + G+
Sbjct  424  INQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQSRRGQ 466

Sequence Alignment: 12. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 131.5 bits 870,  Expect = 1e-31
 Identities = 203/521 38%, Positives = 321/521 61%, Gaps = 62/521 11%
Query  9    FSLFLVSVLVLCLGFAL----AKIDPELK--QCKHQCKVQRQYDEQQKEQCVKECEKYYK 62
            FSLFL S  +LC    +    ++ DP+ +   C+ +C+++ +   +Q ++C    E   K
Sbjct  13   FSLFL-SFGLLCSAKDFPGRRSEDDPQQRYEDCRKRCQLETRGQTEQ-DKCEDRSETQLK 70
Query  63   EKKGRE-----------REHEEEEE-------EWGTGGVDEPSTHEPAEKHLSQCMRQCE 104
            E++ R+           R+H ++EE       E       E   ++  +K++ +C ++C+
Sbjct  71   EEQQRDGEDPQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ 130
Query  105  RQEG-GQQKQLCRFRCQERYKKE--RGQHNYKREDDEDEDEDEAEEEDEN-PYVFEDEDF 160
             QE   ++KQ C   C+E+Y+++  +G+   K  ++E+E+ DE E++  N PY F    F
Sbjct  131  WQEQRPERKQQCVKECREQYQEDPWKGERENKWREEEEEESDEGEQQQRNNPYYFHRRSF 190
Query  161  TTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGR 220
              + + E+G   +L +F  K  LL  + ++R+A+L ANP  FV+P H DA+ I+ V+ GR
Sbjct  191  QERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCDAEKIYVVTNGR 250
Query  221  GTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFH 280
            GT+T +    +ES NV  G +V I +G+  Y+AN D  EKL +  + RPVN PG+F+ F 
Sbjct  251  GTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRPVNNPGQFQKFF 310
Query  281  GPGGENPESFYRAFSWEILEAALKTSKDTLEKL-------FEKQDQGTIMKASKEQIRAM 333
              G ENP+S+ R FS EILEA + T  + L++L         +Q QG   KAS+EQIRA+
Sbjct  311  PAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMFRKASQEQIRAL 370
Query  334  SRRGEGPKIWPFTEESTG-SFKLFKKDPSQSNKYGQLFEA-ERIDYPPLEKLDMVVSYAN 391
            S+    P+     + S G +F L+ + P  SN+ G+++EA  R     L ++D  V    
Sbjct  371  SQGATSPR----GKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQLREVDSSVVAFE 426
Query  392  ITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPS---------------- 435
            I KG + VP YNS+AT + +V  G G VE+ CPHLS   S   S                
Sbjct  427  INKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEEEQEEQEVERRSG 486
Query  436  -YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV-NAEGNIRYTLAGKKNIIKV 493
             YK++RA++    +F+VPAGHP   VAS NE+L ++ F + N + N R  +AGK N ++ 
Sbjct  487  QYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKRIFVAGKTNNVRQ 546
Query  494  MEKEAKELAFKMEGEEVDKVFGKQDEE-FFFQGPEWRKEKEGR 535
             +++AKELAF +E   VD+VF    +E +F  G + R   E R
Sbjct  547  WDRQAKELAFGVESRLVDEVFNNNPQESYFVSGRDRRGFDERR 589

Sequence Alignment: 13. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 130.1 bits 860,  Expect = 3e-31
 Identities = 172/497 34%, Positives = 297/497 59%, Gaps = 41/497 8%
Query  31   ELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDE--PST 88
            E +QC+  CK Q    +QQ+ +  ++ ++ Y+E +   R++EE +         +     
Sbjct  57   EQQQCEESCKSQYGEKDQQQRHRPEDPQRRYEECQQECRQQEERQRPQCQQRCLKRFEQE 116
Query  89   HEPAEKHLSQCMRQCERQEG-GQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEE 147
            ++ +++++ +C ++C +QE   ++KQ C   C+ERY++   +   + E +E+E E+  +E
Sbjct  117  QQQSQRQFQECQQHCHQQEQRPERKQQCVRECRERYQENPWRREREEEAEEEETEEGEQE 176
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            +  NP+ F    F ++ + E+G   +L +F  +  +L  + ++RL++L ANP  FV+P H
Sbjct  177  QSHNPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHH 236
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DA+ I++V+ GRGT+T +    +ES NV  G +V + +G+  Y+AN D  EKL +  + 
Sbjct  237  CDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLH 296
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLF-------EKQDQG 320
            RPVN P +FE F   G + P+S+ RAFS EILE A+ T  + L++LF        +Q QG
Sbjct  297  RPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQG 356
Query  321  TIMKASKEQIRAMSRRGEGPKIWPFTEESTG---SFKLFKKDPSQSNKYGQLFEAERIDY 377
               KAS+EQIRA+S+    P+      E +G   +F L+ + P  SN+ G+++EA   ++
Sbjct  357  MFRKASQEQIRALSQEATSPR------EKSGERFAFNLLYRTPRYSNQNGRFYEACPREF 410
Query  378  PPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHP--- 434
              L  +++ VS   + +G + VP YNS+AT + +V  G G VE+  PHL    S      
Sbjct  411  RQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEE 470
Query  435  --------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCF-----EVN 475
                           Y+K+R+++ +  +F+VPA  P   VAS N+NL +  F      +N
Sbjct  471  QQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNIN 530
Query  476  AEGNIRYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKE 533
             + N R  +AGK N ++  + +AKELAF +    VD++F    +E +F   + ++  E
Sbjct  531  PDHNQRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQRQRASE 588

Sequence Alignment: 14. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 104.4 bits 672,  Expect = 2e-23
 Identities = 157/404 38%, Positives = 250/404 61%, Gaps = 25/404 6%
Query  127  RGQHN-YKREDDEDEDEDEAEEE-DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLL 184
            RG+H  +  E          EEE +ENPYVF  + F  +  +E G++  LP F + S+LL
Sbjct  39   RGHHGVFPEEHGRGHHRGGREEEREENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELL 98
Query  185  HALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSI 244
              + +YR+  +   P   ++P ++DA  I++V+ GRG I  + +N+     + +GD+  +
Sbjct  99   EGISRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGV 158
Query  245  SSGTPFYIANNDENEKLYLVQFLRPVN-LPGHFEVFHGPGGENPESFYRAFSWEILEAAL 303
             SG  FY+ NND++  L +  +LR  + + G +E F+  GG NPE+ Y AFS ++LEAA+
Sbjct  159  PSGHTFYLVNNDDHNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAF 218
Query  304  KTSKDTLEKLFEKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGS------FKLFK 357
             T    LE +F  + +G I  A++EQIR M RRG       F+ EST +      F L  
Sbjct  219  NTDVQKLEHIFGAHRRGVIFYANEEQIREMMRRG------GFSAESTSASEQPKPFNLRN 272
Query  358  KDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEG 417
            + P   N  G++  A   D P L+ +D+ V +  +  G M+ P +N++AT IAIV+ GEG
Sbjct  273  QKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEG 332
Query  418  CVEIACPHLSSSKS-SHP--------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLE 468
             +E+ACPHL      S P        +Y+++RAR+R  TV++VPAGHP   +AS N  LE
Sbjct  333  RIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNGRLE 392
Query  469  IVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKELAFKM-EGEEVDKVFGKQDEEFFFQGPE 527
            I+ F++N  GN R  LAGK N+++ +EKE + L+F +  GEE+++V+  Q ++  ++GP+
Sbjct  393  ILWFDINTSGNEREFLAGKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQ 452
Query  528  WRKEKEGRA 536
             ++  E R+
Sbjct  453  RQRRDEPRS 461

Sequence Alignment: 15. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 103.2 bits 663,  Expect = 3e-23
 Identities = 124/389 31%, Positives = 225/389 57%, Gaps = 17/389 4%
Query  144  EAEEEDENPYVFEDED-FTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAF 202
            +  E++ NP+ F   + F T  + +  ++ LL +F ++S  L  L  YR+  + + P   
Sbjct  25   KVREDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTI 84
Query  203  VVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLY 262
            ++P H DAD ++FV  GR  +T +  + R+S N+  GD   I +GT +Y+ N  +++ L 
Sbjct  85   LLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLK 144
Query  263  LVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF-----EK 316
            ++++  PVN PG ++ F     +  +S+ + FS  ILE ++ +  + + + LF     ++
Sbjct  145  IIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQR 204
Query  317  QDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERID 376
            Q +G I++ SKEQIR +SRR +       + E    F L  ++P  SN +G++FE     
Sbjct  205  QQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDE-PFNLRSRNPIYSNNFGKFFEITPEK 263
Query  377  YPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSH--- 433
             P L  LD+ +S  +I +G + +P +NS+A  I ++  G+  +E+        K  +   
Sbjct  264  NPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEE 323
Query  434  P-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NII 491
            P   ++ RA + +D VF++PA +PF  V +   NL  + F +NAE N R  LAG+K N++
Sbjct  324  PLEVQRYRAELSEDDVFVIPAAYPF--VVNATSNLNFLAFGINAENNQRNFLAGEKDNVV 381
Query  492  KVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535
            + +E++ +ELAF    ++V++++ KQ E +F      +KE+  +GR
Sbjct  382  RQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGR 427

Sequence Alignment: 16. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 75.5 bits 462,  Expect = 9e-15
 Identities = 159/488 32%, Positives = 273/488 55%, Gaps = 44/488 9%
Query  30   PELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE-EEEEW-------GTG 81
            P+  + + Q   +++ DE ++ + +     + + +  +E EHE+ EE+EW       G  
Sbjct  18   PQHPEREPQQPGEKEEDEDEQPRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEK 73
Query  82   GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDED 141
            G +E    E  E    Q  RQ       +QK+       ER ++E      +RE +E ED
Sbjct  74   GSEEEDEDEDEE----QDERQFPFPRPPHQKE-------ERKQEEDEDEEQQRESEESED 122
Query  142  EDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA 201
             +    +++NP++F    F T  K + G++ +L +F Q+S  L+ L  YR+  + + P  
Sbjct  123  SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNT 182
Query  202  FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKL 261
            +++P+H DAD +  +  G   ++ +  + R+S  ++ GD + + SGT +Y+ N D NE L
Sbjct  183  LLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENL 242
Query  262  YLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQ 317
             L+ +  PVN PG FE F     E  +S+ + FS  ILEA+  T  + + K LF   E Q
Sbjct  243  RLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQ 302
Query  318  DQG-------TIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLF 370
             QG        I++ SKEQIRA+S+R +       + E    F L  +DP  SNK G++F
Sbjct  303  QQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFF 361
Query  371  EAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLS 427
            E      P L  LD+ +S  ++ +G + +P +NS+A  I ++  G+  +E+      +  
Sbjct  362  EITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE 421
Query  428  SSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAG 486
              +  +P   +K RA + +  +F++PAG+P    A+ N N+  +   +NAE N R  LAG
Sbjct  422  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAG 479
Query  487  KK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535
             + N+I  +  + +ELAF    + V+K++  Q E +F      +KE+  +GR
Sbjct  480  SQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 531

Sequence Alignment: 17. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 75.6 bits 463,  Expect = 9e-15
 Identities = 162/495 32%, Positives = 275/495 55%, Gaps = 46/495 9%
Query  27   KIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEP 86
            K D E  + + Q +  ++ + +++ +  +E E+  + +  R +E EEEEEEW      +P
Sbjct  70   KHDGEPSRGRSQSEESQEEEHERRREHHREREQEQQPRPQRRQEEEEEEEEW------QP 123
Query  87   STHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYK-KERGQHNYKREDDEDEDEDEA 145
              + P  +      R+   QE G      R    ER + +ER  H  +RE ++D   D  
Sbjct  124  RRQRPQSRREE---REEREQEQGSSSGSQRGGGDERRQHRERRVHREEREQEQDSRSD-- 178
Query  146  EEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVP 205
                 NPY F    F T  +   G++ +L +F Q++  L  L+ YR+  + + P  +++P
Sbjct  179  SRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNTLILP 238
Query  206  SHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQ 265
             H DAD I+ V  GR TIT +  +KR+  N+ QGD + + +GT  YI N D+N+ L + +
Sbjct  239  KHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAK 298
Query  266  FLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLF---------EK 316
            +  P+N PG +  F+    ++ +S++  FS   LEA + T  + +E+++         EK
Sbjct  299  LAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEK 358
Query  317  Q---------DQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYG 367
            Q         D+G I++ SK+QI+ + +  +         ES G F L    P  SNK+G
Sbjct  359  QRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSES-GPFNLRSNKPIYSNKFG 417
Query  368  QLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC--PH 425
             ++E      P ++ L++ +++  I +G + +P YNS+A  I +V  GEG  E+     +
Sbjct  418  NFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQ 477
Query  426  LSSSKSSHPSYKKLRARIR-------KDTVFIVPAGHPFATVASGNENLEIVCFEVNAEG 478
                      Y++    +R       K  VFI+PAGHP++  AS   NL ++ F +NA  
Sbjct  478  QRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASS--NLRLLGFGINANE 535
Query  479  NIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWR--KEKEG 534
            N R  LAG + N+IK +++E KEL F    E+V+++   Q + +F    P+ +  +EKEG
Sbjct  536  NQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQQQQREKEG 595
Query  535  R 535
            R
Sbjct  596  R 596

Sequence Alignment: 18. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 75.4 bits 461,  Expect = 1e-14
 Identities = 159/488 32%, Positives = 273/488 55%, Gaps = 44/488 9%
Query  30   PELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEE-EEEEW-------GTG 81
            P+  + + Q   +++ DE ++ + +     + + +  +E EHE+ EE+EW       G  
Sbjct  80   PQHPEREPQQPGEKEEDEDEQPRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEK 135
Query  82   GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDED 141
            G +E    E  E    Q  RQ       +QK+       ER ++E      +RE +E ED
Sbjct  136  GSEEEDEDEDEE----QDERQFPFPRPPHQKE-------ERNEEEDEDEEQQRESEESED 184
Query  142  EDEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQA 201
             +    +++NP++F    F T  K + G++ +L +F Q+S  L+ L  YR+  + + P  
Sbjct  185  SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNT 244
Query  202  FVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKL 261
            +++P+H DAD +  +  G   ++ +  + R+S  ++ GD + + SGT +Y+ N D NE L
Sbjct  245  LLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENL 304
Query  262  YLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQ 317
             L+ +  PVN PG FE F     E  +S+ + FS  ILEA+  T  + + K LF   E Q
Sbjct  305  RLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQ 364
Query  318  DQG-------TIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLF 370
             QG        I++ SKEQIRA+S+R +       + E    F L  +DP  SNK G++F
Sbjct  365  QQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFF 423
Query  371  EAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLS 427
            E      P L  LD+ +S  ++ +G + +P +NS+A  I ++  G+  +E+      +  
Sbjct  424  EITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE 483
Query  428  SSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAG 486
              +  +P   +K RA + +  +F++PAG+P    A+ N N+  +   +NAE N R  LAG
Sbjct  484  QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAENNQRNFLAG 541
Query  487  KK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535
             + N+I  +  + +ELAF    + V+K++  Q E +F      +KE+  +GR
Sbjct  542  SQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGR 593

Sequence Alignment: 19. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 73.3 bits 446,  Expect = 4e-14
 Identities = 156/490 31%, Positives = 274/490 55%, Gaps = 50/490 10%
Query  36   KHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHEPAEKH 95
            +H  + ++Q+ E+++++   E  + +   + R+  H+EEE E      +E   H   EKH
Sbjct  18   QHPERERQQHGEKEEDE--GEQPRPFPFPRPRQ-PHQEEEHEQK----EEHEWHRKEEKH 70
Query  96   LS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEAEEED 149
                    Q  R+  R    +QK+  +   Q + +K +G+ + + E+D+DEDE++ +E  
Sbjct  71   GGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ 130
Query  150  E----------------NPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLA 193
            E                NP+ F  + F T  K + G V +L +F ++S+ L+ L  YR+ 
Sbjct  131  ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRIL 190
Query  194  VLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIA 253
             + + P  +++P H DAD +  +  G   +T +  + R+S N++ GD + + +GT +Y+ 
Sbjct  191  EFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVV 250
Query  254  NNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK- 312
            N D +E L ++ +  PVN PG FE F     +  +S+ + FS  ILEA+  T  + + K 
Sbjct  251  NPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKV 310
Query  313  LF---EKQDQG-------TIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQ 362
            LF   E Q QG        I++ SK+QIR +S+  +       + E    F L  +DP  
Sbjct  311  LFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDK-PFNLRSRDPIY 369
Query  363  SNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE-- 420
            SNK G+LFE      P L  LD+ +S  ++ +G + +P +NS+A  + ++  GE  +E  
Sbjct  370  SNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELV 429
Query  421  -IACPHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEG 478
             I   +    +  +P   +K RA + +  +F++PAG+P   V +   +L    F +NAE 
Sbjct  430  GIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYP--VVVNATSDLNFFAFGINAEN 487
Query  479  NIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535
            N R  LAG K N+I  +  + +ELAF    ++++ +   Q E +F      +KE+  +GR
Sbjct  488  NQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 547

Sequence Alignment: 20. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 69.4 bits 417,  Expect = 5e-13
 Identities = 137/372 36%, Positives = 218/372 58%, Gaps = 34/372 9%
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  4    DQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 319
             PVN PG++E F   G +N  SF   F+  ILEAA+ T  + +EK L+E Q+Q       
Sbjct  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
Query  320  -----------GTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
                         I+K S+EQI+ +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
Query  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNEN 302
Query  429  SKS-----------SHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 477
             +            +    ++ RA++    VF+VPAGHP A  AS + NL  + F +NA+
Sbjct  303  QREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGINAK 360
Query  478  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 522
             N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  361  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 406

Sequence Alignment: 21. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 69.0 bits 414,  Expect = 6e-13
 Identities = 140/381 36%, Positives = 226/381 59%, Gaps = 34/381 8%
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P +
Sbjct  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DAD I+ V  G+ T+T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 319
             PVN PG+++ F   G +N  S+   FS  ILEAA+ T+ + +EK L+E+Q+Q       
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  320  -----------GTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
                         I+K S+EQI  +S+  +       + ES G F L  ++P  SNK+G+
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES-GPFNLRSRNPIYSNKFGK 242
Query  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
            +FE        L+ LD+ V+  +I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN 302
Query  429  S--------KSSHPSYKKL---RARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 477
                     +    + K++   RA++    VF++PAGHP A  AS + NL  + F +NAE
Sbjct  303  QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE 360
Query  478  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKE 531
             N R  LAG++ N+I  +E+  KELAF     EVD+++  Q + +F      ++E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 22. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 68.4 bits 410,  Expect = 9e-13
 Identities = 140/381 36%, Positives = 225/381 59%, Gaps = 34/381 8%
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            + ENP++F+   F T  + E G + LL KF ++SK++  L+ YRL    + P+ + +P  
Sbjct  4    DQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQC 63
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DAD I+ V  G+ T+T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLT 123
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQ------- 319
             PVN PG+++ F   G +N  S+   FS  ILEAA+ T+ + +EK L+E+Q+Q       
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  320  -----------GTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
                         I+K S+EQI  +S+  +       + ES G F L  ++P  SNK+G+
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSES-GPFNLRSRNPIYSNKFGK 242
Query  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
            +FE        L+ LD+ V+  +I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  243  FFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN 302
Query  429  S--------KSSHPSYKKL---RARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE 477
                     +    + K++   RA++    VF++PAGHP A  AS + NL  + F +NAE
Sbjct  303  QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE 360
Query  478  GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKE 531
             N R  LAG++ N+I  +E+  KELAF     EVD+++  Q + +F      ++E
Sbjct  361  NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 23. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 68.0 bits 407,  Expect = 1e-12
 Identities = 135/372 36%, Positives = 216/372 58%, Gaps = 37/372 9%
Query  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
            + ENP++F+   F T  + E G + LL +F ++SK++  L+ YRL    + P+   +P  
Sbjct  4    DQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
Query  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQGT----- 321
             PVN PG+++ F   G +N  SF   FS  ILEAA+ T  + +EK L+E+Q+Q +     
Sbjct  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
Query  322  -------------IMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
                         I+K S+EQI  +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
Query  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
Query  429  SKSSHP--------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 474
             +                    ++ RAR+    V+++PAGHP A  AS + NL  + F +
Sbjct  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGI 360
Query  475  NAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 522
            NA+ N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409

Sequence Alignment: 24. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 67.5 bits 403,  Expect = 2e-12
 Identities = 127/397 31%, Positives = 226/397 56%, Gaps = 18/397 4%
Query  134  REDDEDEDEDEAEEEDENPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL 192
            RE  E ++E ++  ++ NP+ F  D  F T  K + G + ++ +F Q+SK ++ LE YR+
Sbjct  27   REHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRV 85
Query  193  AVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYI 252
              + + P  +++P H DAD ++ V  GR  +T +  + R+S  + QG    I +GT F++
Sbjct  86   VEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFL 145
Query  253  ANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK 312
             N ++N+ L ++++  PVN P  F+ F     E  +S+ R FS  ILEA++ +    +++
Sbjct  146  VNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDR 205
Query  313  -LF----------EKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPS 361
             LF          E Q++G I++  +EQIR + +  +      ++ +    F L   +P 
Sbjct  206  VLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE-PFNLRNSNPI 264
Query  362  QSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEI 421
             SNK+G+ +E      P L+ LD+ +S  ++ +GG+ +P YNS+A  I ++  GE  +E+
Sbjct  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
Query  422  ACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIR 481
              P     +      ++ RA + +D VF++PA +P A  A+ N N+    F +NAE N R
Sbjct  325  VGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQR 382
Query  482  YTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEG 534
              LAG+K N++  +  E  +++F   G +V+K+  KQ E  F    PE ++ +EG
Sbjct  383  NFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEG 437

Sequence Alignment: 25. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 67.7 bits 405,  Expect = 2e-12
 Identities = 174/513 33%, Positives = 283/513 55%, Gaps = 92/513 17%
Query  11   LFLVSVLVLCLGFALAKIDPELKQ---CKHQC--KVQRQYDEQQKEQCVKECEKYYKEKK 65
            ++L+ +LVL    A     P  K    C ++C    Q++ D+ +++ C   C K   + +
Sbjct  9    MLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPDDLKQKACESRCTKLEYDPR 68
Query  66   GREREHEEEEEEWGTGGVDEPSTHEPAEK-------HLSQCMRQCERQEGGQQKQLC-RF 117
                        + TG  ++   H P E+             RQ  R+EGG+      R 
Sbjct  69   C----------VYDTGATNQ--RHPPGERTRGRQPGDYDDDRRQPRREEGGRWGPAEPRE 116
Query  118  RCQE---RYKKE---RGQHNYKR----EDDEDEDE-----DEAEEED--ENPYVFEDEDF 160
            R +E   R  +E   R  H   R    E  E E E      E  EE    NP+ F    F
Sbjct  117  REREEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSEVREETSRNNPFYFPSRRF 176
Query  161  TTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGR 220
            +T+   + G++ +L +F Q+SK ++ L+ +R+  + A P  +V+P H DAD+I+ +  G+
Sbjct  177  STRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHADADNILVIQQGQ 236
Query  221  GTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFH 280
             T+T    N R+S N+ +G  + I SG   YI N  +N+ L + +   PVN PG+FE F 
Sbjct  237  ATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFF 296
Query  281  GPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQ-------------------DQG 320
                 +  S+ + FS   LEAA+    + + + L+E+                    ++G
Sbjct  297  PASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRRSTRSSDNEG 356
Query  321  TIMKASKEQIRAMSRRGEG-PKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAE-RIDYP 378
             I+K SKE+++ +++  +   K     E+ T    L   +P  SN +G+LFE +     P
Sbjct  357  VIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPDKKNP 416
Query  379  PLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSK-------- 430
             L+ LDM+++   I +G + +P +NS+A  I +V  G G +E+        +        
Sbjct  417  QLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREQEW 476
Query  431  ----------SSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNI 480
                       S+   ++  AR+++  VFI+PA HP A  AS    L ++ F +NAE N 
Sbjct  477  EEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASS--ELHLLGFGINAENNH 534
Query  481  RYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFF------QGPEWRKEKE 533
            R  LAG K N+I  +EK+AK+LAF   GE+V+K+   Q E  F       Q P    EKE
Sbjct  535  RIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQSQSPS-SPEKE 593
Query  534  GRADE 538
             + +E
Sbjct  594  DQEEE 598

Sequence Alignment: 26. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 64.0 bits 378,  Expect = 3e-11
 Identities = 166/507 32%, Positives = 276/507 54%, Gaps = 72/507 14%
Query  11   LFLVSVLVLC-LGFALAKIDPELKQ----CKHQC--KVQRQYDEQQKEQCVKECEKYYKE 63
            ++L+ +LVL  +    AK  P  K+    C ++C    Q++ D+ +++ C   C K   +
Sbjct  9    MLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACESRCTKLEYD 68
Query  64   KKG--REREHEEEEEEWGTGGVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLC-RFRCQ 120
             +     R H     +    G +     +P +    +  RQ  R+EGG+      R R +
Sbjct  69   PRCVYDPRGHTGTTNQRSPPG-ERTRGRQPGDYDDDR--RQPRREEGGRWGPAGPRERER 125
Query  121  E---RYKKE---RGQHNYKR----EDDEDEDE-----DEAEEED--ENPYVFEDEDFTTK 163
            E   R  +E   R  H   R    E  E E E         EE    NP+ F    F+T+
Sbjct  126  EEDWRQPREDWRRPSHQQPRKIRPEGREGEQEWGTPGSHVREETSRNNPFYFPSRRFSTR 185
Query  164  VKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTI 223
               + G++ +L +F Q+S+ ++ L+ +R+  + A P  +V+P H DAD+I+ +  G+ T+
Sbjct  186  YGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHADADNILVIQQGQATV 245
Query  224  TKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPG 283
            T    N R+S N+ +G  + I SG   YI N  +N+ L + +   PVN PG+FE F    
Sbjct  246  TVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMPVNTPGQFEDFFPAS 305
Query  284  GENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQ--------------------DQGTI 322
              +  S+ + FS   LEAA+    + + + L+E+                     ++G I
Sbjct  306  SRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVI 365
Query  323  MKASKEQIRAMSRRGEGPKIWPFTEES--TGSFKLFKKDPSQSNKYGQLFEAE-RIDYPP 379
            +K SKE++  +++  +        EE   T    L + +P  SN +G+LFE +     P 
Sbjct  366  VKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNPQ 425
Query  380  LEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSK--------- 430
            L+ LDM+++   I +G + +P +NS+A  I +V  G G +E+        +         
Sbjct  426  LQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRGRREEEED 485
Query  431  ------SSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTL 484
                   S+   ++  AR+++  VFI+PA HP A  AS    L ++ F +NAE N R  L
Sbjct  486  EDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHLLGFGINAENNHRIFL 543
Query  485  AGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 522
            AG K N+I  +EK+AK+LAF   GE+V+K+   Q E  F
Sbjct  544  AGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHF 582

Sequence Alignment: 27. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 59.9 bits 348,  Expect = 4e-10
 Identities = 128/382 33%, Positives = 209/382 54%, Gaps = 22/382 5%
Query  151  NPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMD 209
            NP+ F  D  F T  + + G + +L +F Q+SK ++ LE YR+  L++ P  +++P H D
Sbjct  45   NPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHAD 104
Query  210  ADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRP 269
            AD ++ V  GR  +T +  + R+S  + QG    I +GT F++ N D+NE L ++++  P
Sbjct  105  ADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVP 164
Query  270  VNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTS-KDTLEKLF-----------EKQ 317
            VN P  F+ F     E  +S+ + FS  ILEA++ +  K+    LF           E Q
Sbjct  165  VNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQ 224
Query  318  DQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDY 377
             +G I++  +EQIR +++  +      ++ E    F L  + P  SNK G+ FE      
Sbjct  225  QEGVIVELKREQIRELTKHAKSSSKKSLSSEDQ-PFNLRNQKPIYSNKLGRWFEITPEKN 283
Query  378  PPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHPS-- 435
            P L  LDM +   ++ +G + +P YNS+A  I ++  G+  +E+        +       
Sbjct  284  PQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEES 343
Query  436  --YKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIK 492
               ++ RA + +D VFI+PA +P A  A+   NL    F +NAE N R  LAG+K N+I 
Sbjct  344  WEVQRYRAELSEDDVFIIPATYPVAINATS--NLNFFAFGINAENNQRNFLAGEKDNVIS 401
Query  493  VMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEGR 535
             +  E  ++ F   GE+V K+  KQ E  F    PE ++ +E R
Sbjct  402  EIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEAR 445

Sequence Alignment: 28. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 59.4 bits 345,  Expect = 7e-10
 Identities = 166/501 33%, Positives = 290/501 57%, Gaps = 77/501 15%
Query  25   LAKIDPELKQCKHQCKVQR---QYDEQQKEQCVKECEKYYKEKKG----RERE-HEEEEE 76
            L K++ E ++C+ + ++ R   Q+ E++++Q  ++ E   ++ +     R R+ H+EEE 
Sbjct  60   LLKVEEE-EECE-EGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEH 117
Query  77   EWGTGGVDEPSTHEPAEKHLS------QCMRQCERQEGGQQKQLCRFRCQERYKKERGQH 130
            E      +E   H   EKH        Q  R+  R    +QK+  +   Q + +K +G+ 
Sbjct  118  EQK----EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKE 173
Query  131  NYKREDDEDEDEDEAEEEDE----------------NPYVFEDEDFTTKVKTEQGKVVLL 174
            + + E+D+DEDE++ +E  E                NP+ F  + F T  K + G V +L
Sbjct  174  SEEEEEDQDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVL 233
Query  175  PKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESI 234
             +F ++S+ L+ L  YR+  + + P  +++P H DAD +  +  G   +T +  + R+S 
Sbjct  234  QRFNKRSQQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSY 293
Query  235  NVRQGDIVSISSGTPFYIAN--NDEN-----------------EKLYLVQFLRPVNLPGH 275
            N++ GD + + +GT FY+ N  NDEN                 E L ++ +  PVN PG 
Sbjct  294  NLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGR 353
Query  276  FEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LF---EKQDQG-------TIMK 324
            FE F     +  +S+ + FS  ILEA+  T  + + K LF   E Q QG        I++
Sbjct  354  FESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVE 413
Query  325  ASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLEKLD 384
             SK+QIR +S+  +       + E    F L  +DP  SNK G+LFE  + + P L  LD
Sbjct  414  ISKKQIRELSKHAKSSSRKTISSEDK-PFNLGSRDPIYSNKLGKLFEITQRN-PQLRDLD 471
Query  385  MVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVE---IACPHLSSSKSSHP-SYKKLR 440
            + +S  ++ +G + +P +NS+A  + ++  GE  +E   I   +    +  +P   +K R
Sbjct  472  VFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYR 531
Query  441  ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAK 499
            A + +  +F++PAG+P    A+ + N+    F +NAE N R  LAG K N+I  +  + +
Sbjct  532  AELSEQDIFVIPAGYPVMVNATSDLNF--FAFGINAENNQRNFLAGSKDNVISQIPSQVQ 589
Query  500  ELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEK--EGR 535
            ELAF    ++++ +   Q E +F      +KE+  +GR
Sbjct  590  ELAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGR 627

Sequence Alignment: 29. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 55.9 bits 318,  Expect = 3e-09
 Identities = 57/181 31%, Positives = 98/181 54%, Gaps = 9/181 4%
Query  353  FKLFKKDPSQSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIV 412
            F L  +DP  S K G++FE      P L  LD+ +S  ++ +G + +P +NS+A  I ++
Sbjct  19   FNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVI 78
Query  413  VSGEGCVEIAC---PHLSSSKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLE 468
              G+  +E+      +    +  +P   +K RA + +  +F++PAG+P   V +   NL 
Sbjct  79   NEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYP--VVVNATSNLN 136
Query  469  IVCFEVNAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPE 527
                 +NAE N R  LAG + N+I  +  + +ELAF    + V+K++  Q E +F     
Sbjct  137  FFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP 196
Query  528  WRKEK--EGR 535
              KE+  +GR
Sbjct  197  NEKEEGNKGR 206

Sequence Alignment: 30. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 37.1 bits 182,  Expect = 0.003
 Identities = 105/415 25%, Positives = 210/415 50%, Gaps = 63/415 15%
Query  96   LSQC-MRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDEDEA---EEEDEN 151
            L +C   Q E+    QQ+Q      Q+R++ +   +N    + +   E EA   E  D+N
Sbjct  16   LFHCSFAQIEQVVNSQQRQQ-----QQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQN 70
Query  152  PYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL--AVLVANPQAFVVPSHMD 209
               ++  +      T Q + +L+P +    +L++ ++   +  AV+   P+ F   S+  
Sbjct  71   EEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQSQ 130
Query  210  ADSIFFVSWGRGTITKILENKRESI-NVRQGDIVSISSGTPFYIANNDENEKLYLV---- 264
            + S       R   ++    + + + ++R+GDI+++ +G   +I NN ++ KL LV    
Sbjct  131  SRS----QHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQS-KLVLVALAD 185
Query  265  ---------QFLRPVNLPGHFEV-FHGPG-----------GENPESFYRAFSWEILEAAL 303
                     Q+LR   L G  +   +G G           G+   +   AF  EIL  ++
Sbjct  186  VGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSF 245
Query  304  KTSKDTLEKLFEKQDQGTIMKASKEQIRAMS-RRGEGPKIWPFTEES--TGSFKLFKKDP 360
                  ++KL  ++ Q  I+   KE ++ +S +R E        EE+  T ++KL   DP
Sbjct  246  NIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYSDNGLEETFCTMTLKLNINDP 305
Query  361  SQSNKY----GQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGE 416
            S+++ Y    G++     ++ P L  L + V    + +  +  P +N  A  I  +  G 
Sbjct  306  SRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGN 365
Query  417  GCVEIACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVA-SGNENLEIVCFEVN 475
            G ++I       S++    + +    IR+  + +VP    FA V  + ++ +E V F+ N
Sbjct  366  GRMQIV------SENGESVFDE---EIREGQLVVVPQN--FAVVKRASSDGFEWVSFKTN 414
Query  476  AEGNIRYTLAGKKNIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGPEWRKEKE 533
                I   LAG+ ++++ +  +  + +F +  E+   +   + E   F  P  R +++
Sbjct  415  GLAKISQ-LAGRISVMRGLPLDVIQNSFDISREDAWNLKESRSEMTIF-APGSRSQRQ 470

Sequence Alignment: 31. Allergen Name: Fag e 3.0101 Sequence ID: A5HIX6

 Score = 34.4 bits 160,  Expect = 0.005
 Identities = 27/93 29%, Positives = 64/93 68%, Gaps = 17/93 18%
Query  31   ELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEEEEEEWGTGGVDEPSTHE 90
            ++++C+++C+  R    ++  +C++ CEK    + G + E  +E + + T    +  + +
Sbjct  10   QIEHCRQRCQ-DRSQGFRETRECLETCEK----RAGFDDEPSKEVDSYTT----DTRSRD 60
Query  91   PAEKHLSQCMRQCERQE-GGQQKQLCRFRCQERYKKERGQHNYKREDDED 139
            P ++ + QC  +C+ QE GG+Q++ C  RC+++ ++++G       DDE+
Sbjct  61   P-QQEFRQCRHRCQTQEEGGRQQRKCEQRCEKQLERQQGY------DDEE 103

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.