The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV
AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL
NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV
QIVNARQ
Sequence Info Allergen Name Length Opt Bits Score E Value
QAT18637 Der p 25.0101 247 1612 374.1 2.3e-105
AIO08860 Der f 25.0201 247 1500 348.6 1.1e-97
L7UZA7 Der f 25.0101 247 1369 318.7 1.1e-88
XP_026795867 Pan h 8.0101 248 1190 277.9 2.1e-76
ACM09737 Sal s 8.01 247 1148 268.4 1.6e-73
A0A1L5YRA2 Scy p 8.0101 248 1143 267.2 3.6e-73
F5A6E97 Pro c 8.0101 248 1117 261.3 2.2e-71
Q8T5G9 Arc s 8.0101 224 1005 235.8 9.3e-64
CAC14917 Tri a TPIS 253 987 231.7 1.9e-62
CAC14917 Tri a 31.0101 253 987 231.7 1.9e-62
F8QN77 Pen m 8.0101 266 917 215.7 1.3e-57
Q0CJH1 Asp t 36.0101 249 912 214.6 2.6e-57
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 25.0101 Sequence ID: QAT18637

 Score = 374.1 bits 1612,  Expect = 2e-105
 Identities = 247/247 100%, Positives = 247/247 100%, Gaps = 0/247 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
            MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV
Sbjct  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
Query  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
            AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL
Sbjct  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
Query  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 2. Allergen Name: Der f 25.0201 Sequence ID: AIO08860

 Score = 348.6 bits 1500,  Expect = 1e-97
 Identities = 227/247 91%, Positives = 240/247 97%, Gaps = 0/247 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
            M RKFFVGGNWKMNGSRATN+DLIK L+N PLDPNT+VVVGVPSIY+A+VR+KL K+IGV
Sbjct  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
Query  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
            AAQNCYKV KGAFTGEISPAMIKDVGAEWVILGHSERRNVFGE+DQLIGEKVEHAL EGL
Sbjct  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            +VIACIGEL+EEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQ+LRQWFS N+SPQIAETIRIIYGGSVTA+NAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 3. Allergen Name: Der f 25.0101 Sequence ID: L7UZA7

 Score = 318.7 bits 1369,  Expect = 1e-88
 Identities = 210/247 85%, Positives = 225/247 91%, Gaps = 0/247 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
            MGRKFFVGGNWKMNG++    +++  L N PLD N EVVVGVP+IYL   ++ L  +I V
Sbjct  1    MGRKFFVGGNWKMNGNKTAIKEIVDFLKNGPLDSNVEVVVGVPAIYLMLCKNILPDNIRV 60
Query  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
            AAQNCYKV KGAFTGEISPAMIKDVGAEWVILGHSERRNVFGE+DQLIGEKVEHAL EGL
Sbjct  61   AAQNCYKVDKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            +VIACIGEL+EEREAGKTTEVVFRQTQVISKHVKDW KVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWFKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQ+LRQ FS N+SPQIAETIRIIYGGSVTA+NAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQKLRQCFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 4. Allergen Name: Pan h 8.0101 Sequence ID: XP_026795867

 Score = 277.9 bits 1190,  Expect = 2e-76
 Identities = 178/245 72%, Positives = 204/245 83%, Gaps = 0/245 0%
Query  2    GRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVA 61
            GRKFFVGGNWKMNG + +  +LI  L +  L+ +TEVV G PSIYL   R KL   IGVA
Sbjct  3    GRKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVA 62
Query  62   AQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLN 121
            AQNCYKVAKGAFTGEISPAMIKD G EWVILGHSERR+VFGE+D+LIG+KV HAL  GL 
Sbjct  63   AQNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLG 122
Query  122  VIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQ 181
            VIACIGE ++EREAG T +VVF QT+ I+ +VKDWSKVV+AYEPVWAIGTGKTASPQQAQ
Sbjct  123  VIACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQ 182
Query  182  EVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQ 241
            EVH +LRQW S NIS  +A ++RIIYGGSVT +  KELA+Q DVDGFLVGGASLKPEFV+
Sbjct  183  EVHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVE 242
Query  242  IVNAR 246
            I+NA+
Sbjct  243  IINAK 247

Sequence Alignment: 5. Allergen Name: Sal s 8.01 Sequence ID: ACM09737

 Score = 268.4 bits 1148,  Expect = 2e-73
 Identities = 171/247 69%, Positives = 194/247 78%, Gaps = 0/247 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
            M RKFFVGGNWKMNG +A+  +LIK L +  LDPNTEVV G PSIYL   R KL   IGV
Sbjct  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
Query  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
            AAQNCYKV  GAFTGEISPAMIKDVG  WVILGHSERR VFGE D+LIG+K  HAL  GL
Sbjct  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
Query  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
             VIACIGE ++EREAG T +V+  QT+  + ++KDWSKVVLAYEPVWAIGTGKTASP QA
Sbjct  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
Query  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
            Q+VH +LRQW   N+S  +A ++RIIYGGSVT    KEL    DVDGFLVGGA+LKPEFV
Sbjct  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
Query  241  QIVNARQ 247
             I+NA+Q
Sbjct  241  DIINAKQ 247

Sequence Alignment: 6. Allergen Name: Scy p 8.0101 Sequence ID: A0A1L5YRA2

 Score = 267.2 bits 1143,  Expect = 4e-73
 Identities = 167/243 68%, Positives = 195/243 80%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVAA 62
            RKFFVGGNWKMNG +A  D +I  +   PL+ +TEVVVG P  YL   R  +  +IGVAA
Sbjct  5    RKFFVGGNWKMNGDKAAIDGIISFMKG-PLNADTEVVVGCPQCYLMYTREHMPANIGVAA 63
Query  63   QNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLNV 122
            QNCYK AKGAFTGEISPAMIKD G EWVILGHSERRNVFGE DQLI EKV HAL  GL V
Sbjct  64   QNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEAGLKV 123
Query  123  IACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            I CIGE +EERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQ+
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQD 183
Query  183  VHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQI 242
            VH +LRQW+  N+SPQ+AE+ RIIYGGSV+A N KELA   D+DGFLVGGASLKP+FV I
Sbjct  184  VHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTI 243
Query  243  VNAR 246
            +NAR
Sbjct  244  INAR 247

Sequence Alignment: 7. Allergen Name: Pro c 8.0101 Sequence ID: F5A6E97

 Score = 261.3 bits 1117,  Expect = 2e-71
 Identities = 165/243 67%, Positives = 192/243 79%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVAA 62
            RKFFVGGNWKMNG RA  D +I  +   PL  +TEVVVG P  YL   R  L  +IGVAA
Sbjct  5    RKFFVGGNWKMNGDRAGIDSIISFMKG-PLSADTEVVVGCPQCYLMYTREHLPSNIGVAA 63
Query  63   QNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLNV 122
            QNCYKVAKGAFTGEISP+MIKD G EWVILGHSERRNVF E D LI EKV HAL  GL V
Sbjct  64   QNCYKVAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKV 123
Query  123  IACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            I CIGE +EERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQE
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQE 183
Query  183  VHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQI 242
            VH +LRQW+  N++ ++A++ RIIYGGSVT  N KELA   D+DGFLVGGASLKP+FVQI
Sbjct  184  VHAKLRQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGGASLKPDFVQI 243
Query  243  VNAR 246
            +NAR
Sbjct  244  INAR 247

Sequence Alignment: 8. Allergen Name: Arc s 8.0101 Sequence ID: Q8T5G9

 Score = 235.8 bits 1005,  Expect = 9e-64
 Identities = 148/224 66%, Positives = 174/224 77%, Gaps = 1/224 0%
Query  8    GGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVAAQNCYK 67
            GGNWKMNG RA+ D +I  +   PL  +TEVVVG P  YL   R  L  +IGVAAQNCYK
Sbjct  1    GGNWKMNGDRASIDSIISFMKG-PLSGDTEVVVGCPQCYLMYTREHLPSNIGVAAQNCYK 59
Query  68   VAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLNVIACIG 127
            VAKGAFTGEISP+MIKD G EWVILGHSERRNVF E D LI EKV HAL  GL VI CIG
Sbjct  60   VAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKVIPCIG 119
Query  128  ELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHQQL 187
            E +EERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQEVH +L
Sbjct  120  EKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQEVHAKL 179
Query  188  RQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGG 232
            RQW+  N++ ++A++ RIIYGGSVT  N KELA   D+DGFLVGG
Sbjct  180  RQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGG 224

Sequence Alignment: 9. Allergen Name: Tri a TPIS Sequence ID: CAC14917

 Score = 231.7 bits 987,  Expect = 2e-62
 Identities = 145/245 59%, Positives = 184/245 75%, Gaps = 2/245 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPN--TEVVVGVPSIYLADVRHKLSKSI 58
            MGRKFFVGGNWK NG+    + ++  L    +      EVVV  P ++L  V+ KL   I
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEI 60
Query  59   GVAAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNE 118
             VAAQNC+    GAFTGE+S  M+ ++G  WVILGHSERR++ GE+ +++GEKV +AL +
Sbjct  61   QVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQ 120
Query  119  GLNVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQ 178
            GL VIAC+GE +E+REAG T  VV  QT+ I+  +KDW+ VV+AYEPVWAIGTGK ASP 
Sbjct  121  GLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPA 180
Query  179  QAQEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPE 238
            QAQEVH  LR W+ TN+SP++AE+ RIIYGGSVT ++ KELA+Q DVDGFLVGGASLKPE
Sbjct  181  QAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPE 240
Query  239  FVQIVNA 245
            F+ I+NA
Sbjct  241  FIDIINA 247

Sequence Alignment: 10. Allergen Name: Tri a 31.0101 Sequence ID: CAC14917

 Score = 231.7 bits 987,  Expect = 2e-62
 Identities = 145/245 59%, Positives = 184/245 75%, Gaps = 2/245 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPN--TEVVVGVPSIYLADVRHKLSKSI 58
            MGRKFFVGGNWK NG+    + ++  L    +      EVVV  P ++L  V+ KL   I
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEI 60
Query  59   GVAAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNE 118
             VAAQNC+    GAFTGE+S  M+ ++G  WVILGHSERR++ GE+ +++GEKV +AL +
Sbjct  61   QVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALAQ 120
Query  119  GLNVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQ 178
            GL VIAC+GE +E+REAG T  VV  QT+ I+  +KDW+ VV+AYEPVWAIGTGK ASP 
Sbjct  121  GLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASPA 180
Query  179  QAQEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPE 238
            QAQEVH  LR W+ TN+SP++AE+ RIIYGGSVT ++ KELA+Q DVDGFLVGGASLKPE
Sbjct  181  QAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKPE 240
Query  239  FVQIVNA 245
            F+ I+NA
Sbjct  241  FIDIINA 247

Sequence Alignment: 11. Allergen Name: Pen m 8.0101 Sequence ID: F8QN77

 Score = 215.7 bits 917,  Expect = 1e-57
 Identities = 129/245 52%, Positives = 177/245 72%, Gaps = 0/245 0%
Query  3    RKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGVAA 62
            RKFFV GNWKMN  +   + ++K++ N  LD NTE VVG PS YL+  R  L+ +IG+AA
Sbjct  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
Query  63   QNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGLNV 122
            QNCYKVA+G F+GEISP MIKD G +WVILGH ERR VF E D +I EKV HA   G+ +
Sbjct  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
Query  123  IACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            IAC+ E  ++R+ G+T EV+F+Q   ++  + DWS+VVLA+E +WA  TG  A+ QQ Q+
Sbjct  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
Query  183  VHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFVQI 242
                +R W+  N+S ++A+T R+IY GSV++ N +E+AS  ++DGFLVGGASLKP+ V I
Sbjct  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
Query  243  VNARQ 247
            +N+R+
Sbjct  245  INSRR 249

Sequence Alignment: 12. Allergen Name: Asp t 36.0101 Sequence ID: Q0CJH1

 Score = 214.6 bits 912,  Expect = 3e-57
 Identities = 134/246 54%, Positives = 184/246 74%, Gaps = 2/246 0%
Query  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
            M R+FFVGGN+KMNG+  +   +IK L +  LD ++EVV+  P++YL   R   + +IGV
Sbjct  1    MPRQFFVGGNFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVANSNIGV 60
Query  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
            AAQN +    GAFTGEIS   ++D   +W ++GHSERR ++ E+D++I  KV+ A++ G+
Sbjct  61   AAQNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGV 120
Query  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHV--KDWSKVVLAYEPVWAIGTGKTASPQ 178
            +VI CIGE +EEREAGKT +VV RQ   ++K +  + W+KVV+AYEPVWAIGTGK A+ +
Sbjct  121  SVIFCIGETLEEREAGKTIDVVTRQLNAVAKELSKEQWAKVVIAYEPVWAIGTGKVATTE 180
Query  179  QAQEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPE 238
            QAQEVH  +R+W++  ISP++++  RIIYGGSV+  N +ELA Q DVDGFLVGGASLKP 
Sbjct  181  QAQEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLVGGASLKPA 240
Query  239  FVQIVNAR 246
            FV I+NAR
Sbjct  241  FVDIINAR 248

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.