The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA
EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK
FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
ADK39021 Ost c 1.0101 160 1025 212.7 3.8e-57
ABZ81040 Car b 1.0109 160 1019 211.5 8.7e-57
ABZ81043 Car b 1.0112 160 1015 210.7 1.5e-56
ABZ81041 Car b 1.0110 160 1014 210.5 1.7e-56
ABZ81042 Car b 1.0111 160 1010 209.7 3e-56
CAB02206 Car b 1.0103 160 1003 208.4 7.9e-56
CAB02209 Car b 1.0106 160 1003 208.4 7.9e-56
CAB02207 Car b 1.0104 160 1002 208.2 9.1e-56
ABZ81044 Car b 1.0113 160 1001 208.0 1e-55
CAA47357 Car b 1.0102 159 997 207.2 1.8e-55
CAB02208 Car b 1.0105 160 991 206.0 4.1e-55
P38949 Car b 1 159 979 203.6 2.1e-54
CAB02213 Car b 1.0107 160 979 203.6 2.2e-54
CAB02215 Car b 1.0108 160 969 201.6 8.5e-54
CAA50327 Cor a 1.0101 160 943 196.4 3.1e-52
CAA50328 Cor a 1.0102 160 939 195.6 5.3e-52
Q08407 Cor a 1 159 936 195.0 8e-52
CAA50326 Cor a 1.0104 160 933 194.4 1.2e-51
CAA50325 Cor a 1.0103 160 932 194.3 1.4e-51
P38950 Car b 1 159 913 190.5 1.9e-50
AAB24432 Aln g 1 160 810 170.0 2.8e-44
Q39427 Bet v 1.0205 160 806 169.2 4.8e-44
CAB02216 Car b 1.0301 161 806 169.2 4.8e-44
CAB02160 Bet v 1.0113 160 805 169.0 5.5e-44
P43186 Bet v 1.0204 160 805 169.0 5.5e-44
P38948 Aln g 1 159 803 168.6 7.2e-44
CAB02217 Car b 1.0302 161 802 168.4 8.4e-44
CAB02159 Bet v 1.0112 160 800 168.0 1.1e-43
CAA33887 Bet v 1.0101 160 800 168.0 1.1e-43
CAB02156 Bet v 1.0109 160 799 167.8 1.3e-43
CAB02161 Bet v 1.0114 160 798 167.6 1.4e-43
P43184 Bet v 1.0203 160 798 167.6 1.4e-43
CAA54421 Bet v 1.0201 160 797 167.4 1.7e-43
CAA04828.1 Bet v 1.0206 159 795 167.0 2.2e-43
CAA96548 Cor a 1.0201 160 795 167.0 2.2e-43
CAA54481 Bet v 1.0202 160 789 165.8 5e-43
CAA07323.1 Bet v 1.0117 160 787 165.4 6.6e-43
CAA54489 Bet v 1.0107 160 787 165.4 6.6e-43
CAA54482 Bet v 1.0102 160 787 165.4 6.6e-43
CAA07329.1 Bet v 1.0118 160 786 165.2 7.5e-43
CAA54487 Bet v 1.0106 160 786 165.2 7.5e-43
CAB02155 Bet v 1.0108 160 786 165.2 7.5e-43
CAA54484 Bet v 1.0104 160 785 165.0 8.7e-43
CAB02157 Bet v 1.0110 160 785 165.0 8.7e-43
CAA54485 Bet v 1.0105 160 784 164.8 9.9e-43
CAA04827.1 Bet v 1.0116 159 782 164.4 1.3e-42
CAA54483 Bet v 1.0103 160 781 164.2 1.5e-42
CAB02158 Bet v 1.0111 160 778 163.7 2.3e-42
CAA96547 Bet v 1.0115 160 773 162.7 4.5e-42
ACF75030.1 Bet v 1.0207 150 750 158.1 9.9e-41
ABC41615.1 Bet v 1.0119 150 732 154.5 1.2e-39
CAA54696.1 Bet v 1.0301 160 712 150.5 2e-38
CAA96549 Cor a 1.0301 160 699 148.0 1.2e-37
AAD48405 Cor a 1.0401 161 672 142.6 5e-36
AAG40329 Cor a 1.0402 161 671 142.4 5.7e-36
AAG40331 Cor a 1.0404 161 669 142.0 7.6e-36
AAG40330 Cor a 1.0403 161 668 141.8 8.7e-36
APD76154 Jug r 5.0101 160 662 140.6 2e-35
ACJ23864 Fag s 1.0101 160 656 139.4 4.5e-35
CAD10374 Cas s 1 160 656 139.4 4.5e-35
CAA96535 Mal d 1.0401 160 650 138.2 1e-34
CAA96536 Mal d 1.0402 160 637 135.6 6.2e-34
CAA96537 Mal d 1.0403 160 633 134.8 1.1e-33
ABZ81046 Que a 1.0301 160 614 131.1 1.5e-32
Q2I6V8 Pru p 1.0101 160 611 130.5 2.2e-32
O24248 Pru av 1 160 609 130.1 2.9e-32
AUH28179 Que m 1.0101 160 591 126.5 3.5e-31
Q256S7 Fra a 1 160 585 125.3 7.9e-31
CAA96534 Mal d 1.0301 159 583 124.9 1e-30
Q3T923 Fra a 1 160 583 124.9 1e-30
AAK13027 Mal d 1.0302 159 579 124.1 1.8e-30
Q256S2 Fra a 1 160 579 124.1 1.8e-30
AFN42528 Can s 5.0101 161 579 124.1 1.8e-30
AAB01362 Mal d 1.0201 159 576 123.5 2.7e-30
AAO25113 Mal d 1.0304 159 576 123.5 2.7e-30
AAD26545 Mal d 1.0202 159 576 123.5 2.7e-30
O50001 Pru ar 1 160 576 123.5 2.7e-30
Q256S6 Fra a 1 160 576 123.5 2.7e-30
AAD13683 Mal d 1.0206 159 575 123.3 3.1e-30
AAD26548 Mal d 1.0204 159 572 122.7 4.7e-30
AAK13030 Mal d 1.0207 159 570 122.3 6.2e-30
AAD26547 Mal d 1.0203 159 570 122.3 6.2e-30
B6CQS9 Pru du 1.0101 160 570 122.3 6.3e-30
CAD32318 Mal d 1.0208 158 569 122.1 7.1e-30
AAD26546 Mal d 1.0103 159 569 122.1 7.1e-30
AAD26558 Mal d 1.0205 159 568 121.9 8.2e-30
AAD29671 Mal d 1.0108 159 567 121.7 9.4e-30
ABZ81047 Que a 1.0401 160 566 121.5 1.1e-29
AAD26552 Mal d 1.0104 159 565 121.3 1.2e-29
O65200 Pyr c 1 159 565 121.3 1.2e-29
Q256S4 Fra a 1 159 564 121.1 1.4e-29
CAA58646 Mal d 1.0101 159 563 120.9 1.6e-29
AAD26555 Mal d 1.0107 159 562 120.7 1.9e-29
AAD26553 Mal d 1.0105 159 561 120.5 2.1e-29
AAD26554 Mal d 1.0106 159 561 120.5 2.1e-29
AAK13029 Mal d 1.0109 159 557 119.7 3.7e-29
AAK13028 Mal d 1.0303 159 557 119.7 3.7e-29
CAA88833 Mal d 1.0102 159 555 119.3 4.9e-29
QGS84240 Que i 1.0101 159 539 116.2 4.4e-28
CAM31908 Act c 8.0101 159 533 115.0 1e-27
ABZ81045 Que a 1.0201 159 531 114.6 1.3e-27
QOL10866 Que ac 1.0101 159 531 114.6 1.3e-27
CAM31909 Act d 8.0101 157 478 104.0 1.9e-24
CAA42646 Gly m 4 158 476 103.7 2.6e-24
Q0Z8U9 Rub i 1.0101 137 474 103.3 2.9e-24
NP_001275580 Sola l 4.0201 160 465 101.5 1.2e-23
AHC08073 Sola l 4.0101 160 462 100.9 1.8e-23
AAQ91847 Ara h 8.0101 157 453 99.1 6.1e-23
CAA43637 Pha v 1 156 447 97.9 1.4e-22
CAA43636 Pha v 1 155 446 97.7 1.6e-22
P25985 Pha v 1 155 440 96.5 3.6e-22
EF436550 Ara h 8.0201 153 420 92.5 5.6e-21
CAA75803 Lyc e 4.0101 178 419 92.3 7.7e-21
Q2VU97 Vig r 1.0101 155 403 89.2 5.9e-20
AAB92255 Tar o RAP 157 393 87.2 2.4e-19
CAA67246 Pet c PR10 155 388 86.2 4.6e-19
P49372 Api g 1 154 386 85.8 6.1e-19
P92918 Api g 1.0201 159 377 84.0 2.2e-18
CAB03716 Dau c 1.0104 154 376 83.8 2.4e-18
CAB06416 Dau c 1.0105 154 373 83.2 3.6e-18
AAL76932 Dau c 1.0201 154 372 83.0 4.2e-18
BAA13604 Dau c 1.0102 154 370 82.6 5.5e-18
AAB01092 Dau c 1.0101 168 368 82.2 8e-18
CAB03715 Dau c 1.0103 154 362 81.0 1.7e-17
Q5ULZ4 Fra a 1.0101 100 261 61.1 1.1e-11
P85126 Que a 1.0101 50 184 46.0 1.9e-07
Q9ZWP8 Vig r 6.0101 155 157 40.3 3e-05
Q9S8Q4 Cas s 1 24 100 29.5 0.0082
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 212.7 bits 1025,  Expect = 4e-57
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 2. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 211.5 bits 1019,  Expect = 9e-57
 Identities = 159/160 99%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 3. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 210.7 bits 1015,  Expect = 2e-56
 Identities = 158/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 4. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 210.5 bits 1014,  Expect = 2e-56
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGS++KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 5. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 209.7 bits 1010,  Expect = 3e-56
 Identities = 157/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 208.4 bits 1003,  Expect = 8e-56
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 208.4 bits 1003,  Expect = 8e-56
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 208.2 bits 1002,  Expect = 9e-56
 Identities = 156/160 97%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGD LEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 9. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 208.0 bits 1001,  Expect = 1e-55
 Identities = 156/160 97%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFKFVKERVDEVDNANFKY+YTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 207.2 bits 997,  Expect = 2e-55
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAIS VENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 11. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 206.0 bits 991,  Expect = 4e-55
 Identities = 155/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 203.6 bits 979,  Expect = 2e-54
 Identities = 153/159 96%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQ IS VENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            G PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAE+MKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 13. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 203.6 bits 979,  Expect = 2e-54
 Identities = 154/160 96%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFKSYVLD DKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS ELKIVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 201.6 bits 969,  Expect = 9e-54
 Identities = 152/160 95%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 15. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 196.4 bits 943,  Expect = 3e-52
 Identities = 145/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 16. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 195.6 bits 939,  Expect = 5e-52
 Identities = 145/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 17. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 195.0 bits 936,  Expect = 8e-52
 Identities = 144/159 90%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 18. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 194.4 bits 933,  Expect = 1e-51
 Identities = 144/160 90%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSVI AARLFKSYVLDGDKLIPKVAPQAI+ VENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NFKY+YTVIEGDVLGDKLEKV  ELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 19. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 194.3 bits 932,  Expect = 1e-51
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 190.5 bits 913,  Expect = 2e-50
 Identities = 140/159 88%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+S VENV GNGGPGTIK ITF+E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GSP K+VKERV+E+D+ NFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 170.0 bits 810,  Expect = 3e-44
 Identities = 121/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVIPAARLFK+++LDGDKL+PKVAP+A+S VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD  NFKY+++VIEG  +GD LEKV +E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FH KGDHE+NAE++K  KE A  LL+AVESYLLAH+  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 169.2 bits 806,  Expect = 5e-44
 Identities = 121/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+K+VA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE AE LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 169.2 bits 806,  Expect = 5e-44
 Identities = 121/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+S VENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 169.0 bits 805,  Expect = 6e-44
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 169.0 bits 805,  Expect = 6e-44
 Identities = 121/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++LDGD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 168.6 bits 803,  Expect = 7e-44
 Identities = 120/159 75%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSVIPAARLFK+++LDGDKL+PKVAP+A+S VEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GSPFK+VKERVDEVD  NFKY+++VIEG  +GD LEKV +E+KIVAAP GGSILKIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHE+NAE++K  KE A  LL+AVESYLLAH+  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 27. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 168.4 bits 802,  Expect = 8e-44
 Identities = 121/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SVIPAARLFK+++LDG+ LIPKVAPQA+S VENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 168.0 bits 800,  Expect = 1e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSILKIS+K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 168.0 bits 800,  Expect = 1e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 167.8 bits 799,  Expect = 1e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 167.6 bits 798,  Expect = 1e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 167.6 bits 798,  Expect = 1e-43
 Identities = 120/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 167.4 bits 797,  Expect = 2e-43
 Identities = 120/160 75%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 167.0 bits 795,  Expect = 2e-43
 Identities = 119/159 74%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYE+ET SVIPAARLFK+++LDGD LIPKVAPQAIS VEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+K+VA P GGSILKIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 35. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 167.0 bits 795,  Expect = 2e-43
 Identities = 118/160 73%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E+ SVIPAARLFK+++LDG+ LIPKVAPQA+S VENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV+AE +KG KE  E L+RAVE+YLLAH+  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 165.8 bits 789,  Expect = 5e-43
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 165.4 bits 787,  Expect = 7e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 165.4 bits 787,  Expect = 7e-43
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAAR+FK+++LDGDKL+PKVAPQAIS VEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 165.4 bits 787,  Expect = 7e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAIS VEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 165.2 bits 786,  Expect = 8e-43
 Identities = 117/160 73%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSIL+IS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 165.2 bits 786,  Expect = 8e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 165.2 bits 786,  Expect = 8e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 165.0 bits 785,  Expect = 9e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 165.0 bits 785,  Expect = 9e-43
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 164.8 bits 784,  Expect = 1e-42
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 164.4 bits 782,  Expect = 1e-42
 Identities = 116/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            G PFK+VK+RVDEVD+ANFKY+Y++IEG  +GD LEK+S+E+KIVA P GGSILKIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 164.2 bits 781,  Expect = 2e-42
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+KIVA P GGSILKI++K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 163.7 bits 778,  Expect = 2e-42
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
             G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG +LKIS+K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 162.7 bits 773,  Expect = 5e-42
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 158.1 bits 750,  Expect = 1e-40
 Identities = 113/150 75%, Positives = 130/150 86%, Gaps = 0/150 0%
Query  4    FNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAEGS 63
            FNYE+ET SVIPAARLFK+++L+GD LIPKVAPQAIS VEN+ GNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHA 123
            PFK+VKERVDEVD+ANFKY+Y++IEG  LGD LEK+ +E+KIVA P GGSILKIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVNAEEMKGAKEMAEKLLRAVESYLL 153
            KGDHE+ AE MK  KE  E LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 154.5 bits 732,  Expect = 1e-39
 Identities = 109/150 72%, Positives = 128/150 85%, Gaps = 0/150 0%
Query  4    FNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAEGS 63
            FNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS V+N+ GNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHA 123
            PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+KIVA P GG ILKIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVNAEEMKGAKEMAEKLLRAVESYLL 153
            KG+HEV AE++K +KEM E LLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 150.5 bits 712,  Expect = 2e-38
 Identities = 107/160 66%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVI  ARLFKS+VLD D LIPKVAP+ +S  EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS FK++K RVDE+D+ANFKY Y++IEG  LGD LEK+S+E+KIVAAPGGGSILKI+SK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD  +N EE+K  KE    L++AVE+YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 148.0 bits 699,  Expect = 1e-37
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIP ARLFK +VLD D LIPKVAP+AI  +E + GNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSPF ++K++V+E+D ANF Y Y+VIEGD L DKLEK+++E+KIVA+P GGSILK  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H  GDHE+  E++K  KE A  L++AVE YLLAH+  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 142.6 bits 672,  Expect = 5e-36
 Identities = 102/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSILKISS 119
            EG+ FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  +N EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 142.4 bits 671,  Expect = 6e-36
 Identities = 102/159 64%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSILKISS 119
            EGS FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  ++ EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 142.0 bits 669,  Expect = 8e-36
 Identities = 101/159 63%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSILKISS 119
            EG+ FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  +N EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 141.8 bits 668,  Expect = 9e-36
 Identities = 102/159 64%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAP-GGGSILKISS 119
            EGS FK++K +V+E+D+ANFKY Y++IEG  LG  LEK+S+E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  ++ EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 140.6 bits 662,  Expect = 2e-35
 Identities = 99/160 61%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+   E + GNGGPGTIK I F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K+VK R D +D ANF Y Y+VIEGD L DK+EK+S+E KIVA+  GGSILK  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 59. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 139.4 bits 656,  Expect = 4e-35
 Identities = 96/160 60%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+ET +VI  ARLFK++VLD D LIPKVAPQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS F +VK R+DE+DNANF Y  T+IEGD + + LEK+++E+K+VA+P GGSILK +SK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 60. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 139.4 bits 656,  Expect = 4e-35
 Identities = 97/160 60%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S IP  RLFK++VLD D LIPK+AP+AI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS FK+VK R+DE+D ANF Y Y+VIEGDV+ + LEK+S+E+KIVA+P GGSILK +SK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG++E+  E++   KE A  L++AVE+YLLAH+  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 138.2 bits 650,  Expect = 1e-34
 Identities = 93/160 58%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 135.6 bits 637,  Expect = 6e-34
 Identities = 91/160 56%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI   + + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 134.8 bits 633,  Expect = 1e-33
 Identities = 91/160 56%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            + AKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 131.1 bits 614,  Expect = 1e-32
 Identities = 93/159 58%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLFK++VLD D LIPKV PQA+   E + GNGGPGTIK ITF 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSI+K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 130.5 bits 611,  Expect = 2e-32
 Identities = 88/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D +D  N  Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 130.1 bits 609,  Expect = 3e-32
 Identities = 87/160 54%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S IP  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D +D  N+ Y+YT+IEGD LGD LEK+S+E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 126.5 bits 591,  Expect = 3e-31
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  YE+E  SVIP ARLFK++VLD D LIPKV PQA+   E + GNGGPGTIK ITF 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K  K R+D +D  NF ++++VIEGD L DKLE VS E KIVA+P GGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 68. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 125.3 bits 585,  Expect = 8e-31
 Identities = 84/160 52%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 69. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 124.9 bits 583,  Expect = 1e-30
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 70. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 124.9 bits 583,  Expect = 1e-30
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 71. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 124.1 bits 579,  Expect = 2e-30
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VAA G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 72. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 124.1 bits 579,  Expect = 2e-30
 Identities = 82/160 51%, Positives = 114/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L + +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 73. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 124.1 bits 579,  Expect = 2e-30
 Identities = 83/160 51%, Positives = 122/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S I  ARLFK++VLDGD L+PK+APQA+ KVE + GNGG GTIK ITF 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVL-GDKLEKVSHELKIVAAPGGGSILKISS 119
            +G PFK+VK +++ +D  ++ Y+Y++IEGD L G++LEK++HE K+VA+  GG+++K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            K+++ GD +VN E++K  ++ A ++L+ VE+YL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 74. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 123.5 bits 576,  Expect = 3e-30
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 123.5 bits 576,  Expect = 3e-30
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 76. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 123.5 bits 576,  Expect = 3e-30
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 77. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 123.5 bits 576,  Expect = 3e-30
 Identities = 84/160 52%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK RVD +D  N+ Y+YT+IEGD L D +E +++++K+VA+P GGSI+K +S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 78. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 123.5 bits 576,  Expect = 3e-30
 Identities = 83/160 51%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG + YE E  S IPA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 79. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 123.3 bits 575,  Expect = 3e-30
 Identities = 88/159 55%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK +VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 122.7 bits 572,  Expect = 5e-30
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K++A+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 122.3 bits 570,  Expect = 6e-30
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGT K ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 122.3 bits 570,  Expect = 6e-30
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ES+L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 122.3 bits 570,  Expect = 6e-30
 Identities = 81/160 50%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG+F Y  E+ SVIP  RLFK+ VL+ D LIPK+APQ++   E V G+GG GTIK I+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D +D  NF YNY+++EGD L DK+EK+S+E+K+VA+  GGS++K +S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E++K  KE A  L++ +E+YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 84. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 122.1 bits 569,  Expect = 7e-30
 Identities = 88/158 55%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GV+ YE E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
            GS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 85. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 122.1 bits 569,  Expect = 7e-30
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 121.9 bits 568,  Expect = 8e-30
 Identities = 87/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD AN+ Y YT+IEGD L D +EKVS+E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 121.7 bits 567,  Expect = 9e-30
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 88. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 121.5 bits 566,  Expect = 1e-29
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS +K  K R+D +D  NF Y+++VIEGD L DKLE VS E KIVA+P GGSI K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 121.3 bits 565,  Expect = 1e-29
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 90. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 121.3 bits 565,  Expect = 1e-29
 Identities = 86/159 54%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG++ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK RVD +D A++ Y YT+IEGD L D +EK+S+E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 121.1 bits 564,  Expect = 1e-29
 Identities = 82/159 51%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++  +D  N  Y+Y++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 92. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 120.9 bits 563,  Expect = 2e-29
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 120.7 bits 562,  Expect = 2e-29
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  K  A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 120.5 bits 561,  Expect = 2e-29
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 120.5 bits 561,  Expect = 2e-29
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +E +S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 119.7 bits 557,  Expect = 4e-29
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 119.7 bits 557,  Expect = 4e-29
 Identities = 83/159 52%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SVIP ARL+ ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK ++D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 119.3 bits 555,  Expect = 5e-29
 Identities = 83/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G G+ +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE    L++ +ESYL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 116.2 bits 539,  Expect = 4e-28
 Identities = 84/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI  +E + GNGGPGTIK ITF 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 115.0 bits 533,  Expect = 1e-27
 Identities = 80/155 51%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 101. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 114.6 bits 531,  Expect = 1e-27
 Identities = 84/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SVI  ARLFK+  LD D LI KV PQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E S FK+ K R+D +D  N  Y+++VIEGD L   +E VS E+K VA+P GGSI+K ++K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 102. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 114.6 bits 531,  Expect = 1e-27
 Identities = 80/159 50%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV+NYE++  SVIP ARLFK++VLD D LI KV P+A+   E + GNGGPGTIK  TF 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E S  K+ K R+D +D  N  Y+++VIEG+ L D +  +S E+K VA+P GGSI+K ++K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 104.0 bits 478,  Expect = 2e-24
 Identities = 76/154 49%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG   Y+ E PS I A ++FK++VLDGD +IPK  P+AI+ V+ + G+GG GTIK  TF 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGS  K VK R+D +D  NF Y+Y++IEG  L D +E +S+ +KIVA P GG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +  K D +V+ EE+K  KE A  +++ VE+YLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 103.7 bits 476,  Expect = 3e-24
 Identities = 76/158 48%, Positives = 105/158 66%, Gaps = 2/158 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +  A L+K+ V D D +IPK A  +   VENV GNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E    KFV  +++ +D AN+ Y+Y+V+ G  L D  EK++ + K+VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +  KGD E N +E+K  K  A+ L++A+E+YLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 103.3 bits 474,  Expect = 3e-24
 Identities = 68/134 50%, Positives = 99/134 73%, Gaps = 1/134 0%
Query  12   SVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAEGSPFKFVKER 71
            SVIP  +LFK++VLD D LIPK+APQA+  VE + G+GG GT+K I + EG+   +VK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHAKGDHEVNA 131
            +D +D  NF Y+Y++ EGD LGDK+EK+S+E+K+VA+ G GSI+K +S +H KG  E+  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EEMKGAKEMAEKLLR 146
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 101.5 bits 465,  Expect = 1e-23
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + +  +E V G+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 100.9 bits 462,  Expect = 2e-23
 Identities = 65/159 40%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q +   E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 99.1 bits 453,  Expect = 6e-23
 Identities = 69/157 43%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +P A+L+ + + D D + PK+    +  VE V GNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 97.9 bits 447,  Expect = 1e-22
 Identities = 65/155 41%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGVF +E +T S +  A L+K+   D D + PK  P +   VE V GNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E    KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 97.7 bits 446,  Expect = 2e-22
 Identities = 67/154 43%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            M VF +E +T S +  A L+K+ V D D ++PK A  +   VE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E    KFV  +++E+D AN+ Y+Y+++ G  L D  EK+S + K+   P GGS++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 96.5 bits 440,  Expect = 4e-22
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
            GVF +E +T S +  A L+K+   D D + PK  P +   VE V GNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 92.5 bits 420,  Expect = 6e-21
 Identities = 65/153 42%, Positives = 100/153 65%, Gaps = 2/153 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +E E+ S +P A+LFK+ V+DGD+L PK+ P AI  +E V GNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E     +V  ++D +D A + Y+YT+  G  + + LEKVS + K+ AA GG  I K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKI-KVSVT 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 92.3 bits 419,  Expect = 8e-21
 Identities = 59/142 41%, Positives = 93/142 65%, Gaps = 1/142 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q +   E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE +++++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEEMK-GAKEMAE 142
            +H KGDH V+ EE   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 114. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 89.2 bits 403,  Expect = 6e-20
 Identities = 63/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            M VF ++ +  S +  A L+ +   D D +IPK A  +   VE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E    KFV  +++ VD AN+ Y+Y+++ G  L D  EK++ + KI     GGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 87.2 bits 393,  Expect = 2e-19
 Identities = 60/153 39%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            M V  +E  T S+ P+  +FK++V+D D + PK  P+    ++ + G+GG GTIK+IT++
Sbjct  1    MAVAEFEI-TSSLSPSN-IFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            +G PF   K +VD +D+ NF  +YT+ EGDVL   +E  +H LK + +  GGS+ K S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            F  KGD ++  E +   KE  +K ++A+E+Y+++H
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 86.2 bits 388,  Expect = 5e-19
 Identities = 59/155 38%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            + SP+K +K+++D +D   F ++Y++I+GD+L   ++ +++ L  V    GG     ++ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 85.8 bits 386,  Expect = 6e-19
 Identities = 60/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A   VE + G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            +G P   +  R+D V+   + ++Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 84.0 bits 377,  Expect = 2e-18
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV     E PS + A ++++ ++LD D + PKV PQ I  VE + G+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E + +  +K++VD +D A + Y YT I GD+L D LE V +E+ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 83.8 bits 376,  Expect = 2e-18
 Identities = 63/154 40%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A   V+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 83.2 bits 373,  Expect = 4e-18
 Identities = 63/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A   VE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 83.0 bits 372,  Expect = 4e-18
 Identities = 58/154 37%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MGV   E E PS + A ++++ ++LD D + PKV PQ I  VE + G+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E + +  +K++VD +D A + Y YT I GD+L + LE V +++ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 82.6 bits 370,  Expect = 5e-18
 Identities = 61/154 39%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A   V+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 82.2 bits 368,  Expect = 8e-18
 Identities = 61/154 39%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A   V+ V G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 81.0 bits 362,  Expect = 2e-17
 Identities = 61/154 39%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK A  A   VE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            EGSP   +  R D V+   + Y+ TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 61.1 bits 261,  Expect = 1e-11
 Identities = 37/80 46%, Positives = 53/80 66%, Gaps = 0/80 0%
Query  81   KYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKGAKEM 140
            +Y Y  +EGD L D LEK+ +E K+V+AP   +I+K +SK+H KGD E+  E +K  KE 
Sbjct  21   QYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEK 80
Query  141  AEKLLRAVESYLLAHTAEYN 160
            A  L++ +E YL  H +EYN
Sbjct  81   AAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 46.0 bits 184,  Expect = 2e-07
 Identities = 29/50 58%, Positives = 34/50 68%, Gaps = 0/50 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGP 51
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI   E + GNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 40.3 bits 157,  Expect = 3e-05
 Identities = 42/145 28%, Positives = 73/145 50%, Gaps = 15/145 10%
Query  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITF-A 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       +++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLL---RAVESYLLAHTA 157
            +    DH+ + EE     + ++  L   R +E YL   +A
Sbjct  120  Y----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 29.5 bits 100,  Expect = 0.008
 Identities = 15/24 62%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVFNYEAETPSVIPAARLFKSYVL 25
            GVF +E++  SVIP ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.