The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK
FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB02215 Car b 1.0108 160 1021 233.8 1.7e-63
CAB02213 Car b 1.0107 160 1010 231.4 9.1e-63
CAB02209 Car b 1.0106 160 982 225.2 6.6e-61
ABZ81040 Car b 1.0109 160 974 223.5 2.3e-60
ABZ81043 Car b 1.0112 160 970 222.6 4.2e-60
CAB02208 Car b 1.0105 160 970 222.6 4.2e-60
ABZ81041 Car b 1.0110 160 969 222.4 4.8e-60
ADK39021 Ost c 1.0101 160 969 222.4 4.8e-60
ABZ81044 Car b 1.0113 160 966 221.7 7.7e-60
ABZ81042 Car b 1.0111 160 965 221.5 8.9e-60
CAB02206 Car b 1.0103 160 958 219.9 2.6e-59
CAB02207 Car b 1.0104 160 957 219.7 3e-59
CAA47357 Car b 1.0102 159 952 218.6 6.5e-59
P38949 Car b 1 159 934 214.6 1e-57
CAA50328 Cor a 1.0102 160 915 210.4 1.9e-56
CAA50326 Cor a 1.0104 160 909 209.1 4.7e-56
CAA50327 Cor a 1.0101 160 908 208.9 5.5e-56
Q08407 Cor a 1 159 901 207.3 1.6e-55
CAA50325 Cor a 1.0103 160 897 206.5 3e-55
P38950 Car b 1 159 868 200.1 2.5e-53
AAB24432 Aln g 1 160 787 182.2 6.1e-48
Q39427 Bet v 1.0205 160 783 181.3 1.1e-47
P43186 Bet v 1.0204 160 782 181.1 1.3e-47
P38948 Aln g 1 159 780 180.6 1.8e-47
CAB02216 Car b 1.0301 161 779 180.4 2.1e-47
P43184 Bet v 1.0203 160 775 179.5 3.8e-47
CAB02217 Car b 1.0302 161 775 179.5 3.8e-47
CAA54421 Bet v 1.0201 160 774 179.3 4.4e-47
CAA04828.1 Bet v 1.0206 159 772 178.9 6e-47
CAA96548 Cor a 1.0201 160 772 178.9 6e-47
CAB02160 Bet v 1.0113 160 772 178.9 6e-47
CAB02159 Bet v 1.0112 160 767 177.8 1.3e-46
CAA33887 Bet v 1.0101 160 767 177.8 1.3e-46
CAB02156 Bet v 1.0109 160 766 177.5 1.5e-46
CAA54481 Bet v 1.0202 160 766 177.5 1.5e-46
CAB02161 Bet v 1.0114 160 765 177.3 1.8e-46
CAA54487 Bet v 1.0106 160 763 176.9 2.4e-46
CAA54484 Bet v 1.0104 160 762 176.6 2.8e-46
CAA04827.1 Bet v 1.0116 159 759 176.0 4.4e-46
CAA54483 Bet v 1.0103 160 758 175.8 5.1e-46
CAA07323.1 Bet v 1.0117 160 754 174.9 9.5e-46
CAA54489 Bet v 1.0107 160 754 174.9 9.5e-46
CAA54482 Bet v 1.0102 160 754 174.9 9.5e-46
CAA07329.1 Bet v 1.0118 160 753 174.7 1.1e-45
CAB02155 Bet v 1.0108 160 753 174.7 1.1e-45
CAB02157 Bet v 1.0110 160 752 174.4 1.3e-45
CAA54485 Bet v 1.0105 160 751 174.2 1.5e-45
CAA96547 Bet v 1.0115 160 750 174.0 1.7e-45
CAB02158 Bet v 1.0111 160 745 172.9 3.8e-45
ACF75030.1 Bet v 1.0207 150 727 168.9 5.4e-44
ABC41615.1 Bet v 1.0119 150 699 162.8 3.9e-42
CAA54696.1 Bet v 1.0301 160 693 161.4 1.1e-41
CAA96549 Cor a 1.0301 160 679 158.3 9.1e-41
AAD48405 Cor a 1.0401 161 653 152.6 4.9e-39
AAG40331 Cor a 1.0404 161 650 151.9 7.8e-39
AAG40329 Cor a 1.0402 161 649 151.7 9.1e-39
AAG40330 Cor a 1.0403 161 646 151.0 1.4e-38
APD76154 Jug r 5.0101 160 644 150.6 1.9e-38
ACJ23864 Fag s 1.0101 160 638 149.3 4.9e-38
CAD10374 Cas s 1 160 637 149.0 5.7e-38
CAA96535 Mal d 1.0401 160 625 146.4 3.6e-37
CAA96536 Mal d 1.0402 160 612 143.5 2.6e-36
CAA96537 Mal d 1.0403 160 608 142.6 4.8e-36
ABZ81046 Que a 1.0301 160 602 141.3 1.2e-35
AUH28179 Que m 1.0101 160 590 138.7 7.5e-35
Q2I6V8 Pru p 1.0101 160 589 138.4 8.8e-35
O24248 Pru av 1 160 587 138.0 1.2e-34
Q256S7 Fra a 1 160 566 133.4 3e-33
Q3T923 Fra a 1 160 564 132.9 4e-33
CAA96534 Mal d 1.0301 159 563 132.7 4.7e-33
Q256S2 Fra a 1 160 560 132.0 7.4e-33
AAK13027 Mal d 1.0302 159 559 131.8 8.6e-33
Q256S6 Fra a 1 160 557 131.4 1.2e-32
O50001 Pru ar 1 160 557 131.4 1.2e-32
AAO25113 Mal d 1.0304 159 556 131.2 1.4e-32
ABZ81047 Que a 1.0401 160 554 130.7 1.9e-32
AAD26545 Mal d 1.0202 159 552 130.3 2.5e-32
AAB01362 Mal d 1.0201 159 552 130.3 2.5e-32
AAD13683 Mal d 1.0206 159 551 130.1 2.9e-32
AAD26548 Mal d 1.0204 159 548 129.4 4.6e-32
AAD26547 Mal d 1.0203 159 546 129.0 6.3e-32
AAK13030 Mal d 1.0207 159 546 129.0 6.3e-32
AAD26546 Mal d 1.0103 159 546 129.0 6.3e-32
CAD32318 Mal d 1.0208 158 545 128.7 7.3e-32
Q256S4 Fra a 1 159 545 128.7 7.3e-32
AAD29671 Mal d 1.0108 159 544 128.5 8.5e-32
AAD26558 Mal d 1.0205 159 544 128.5 8.5e-32
B6CQS9 Pru du 1.0101 160 544 128.5 8.6e-32
AAD26552 Mal d 1.0104 159 542 128.1 1.2e-31
O65200 Pyr c 1 159 541 127.9 1.3e-31
CAA58646 Mal d 1.0101 159 540 127.6 1.6e-31
AAD26555 Mal d 1.0107 159 539 127.4 1.8e-31
AAD26553 Mal d 1.0105 159 538 127.2 2.1e-31
AAD26554 Mal d 1.0106 159 538 127.2 2.1e-31
AAK13028 Mal d 1.0303 159 537 127.0 2.5e-31
CAA88833 Mal d 1.0102 159 534 126.3 3.9e-31
AAK13029 Mal d 1.0109 159 534 126.3 3.9e-31
AFN42528 Can s 5.0101 161 533 126.1 4.7e-31
QGS84240 Que i 1.0101 159 528 125.0 9.9e-31
ABZ81045 Que a 1.0201 159 520 123.2 3.4e-30
QOL10866 Que ac 1.0101 159 520 123.2 3.4e-30
CAM31908 Act c 8.0101 159 505 119.9 3.3e-29
CAA42646 Gly m 4 158 468 111.7 9.5e-27
NP_001275580 Sola l 4.0201 160 465 111.1 1.5e-26
Q0Z8U9 Rub i 1.0101 137 458 109.6 3.6e-26
AHC08073 Sola l 4.0101 160 458 109.5 4.5e-26
CAM31909 Act d 8.0101 157 450 107.8 1.5e-25
CAA43636 Pha v 1 155 443 106.2 4.3e-25
CAA43637 Pha v 1 156 440 105.6 6.8e-25
AAQ91847 Ara h 8.0101 157 436 104.7 1.3e-24
P25985 Pha v 1 155 433 104.0 2e-24
CAA75803 Lyc e 4.0101 178 415 100.0 3.7e-23
Q2VU97 Vig r 1.0101 155 400 96.7 3.1e-22
EF436550 Ara h 8.0201 153 397 96.1 4.8e-22
CAA67246 Pet c PR10 155 395 95.6 6.6e-22
AAB92255 Tar o RAP 157 395 95.6 6.7e-22
P49372 Api g 1 154 390 94.5 1.4e-21
CAB03716 Dau c 1.0104 154 378 91.9 8.8e-21
CAB06416 Dau c 1.0105 154 375 91.2 1.4e-20
BAA13604 Dau c 1.0102 154 372 90.6 2.2e-20
P92918 Api g 1.0201 159 372 90.5 2.3e-20
AAB01092 Dau c 1.0101 168 370 90.1 3.4e-20
AAL76932 Dau c 1.0201 154 367 89.4 4.8e-20
CAB03715 Dau c 1.0103 154 364 88.8 7.5e-20
Q5ULZ4 Fra a 1.0101 100 242 62.1 5.4e-12
P85126 Que a 1.0101 50 183 49.4 1.8e-08
Q9ZWP8 Vig r 6.0101 155 164 44.6 1.5e-06
Q9S8Q4 Cas s 1 24 97 30.7 0.0035
P85524 Act d 11.0101 150 107 32.1 0.0088
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 233.8 bits 1021,  Expect = 2e-63
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 2. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 231.4 bits 1010,  Expect = 9e-63
 Identities = 158/160 98%, Positives = 159/160 99%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLEL IVAAPGGGSILKISGK
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 3. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 225.2 bits 982,  Expect = 7e-61
 Identities = 153/160 95%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 4. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 223.5 bits 974,  Expect = 2e-60
 Identities = 153/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 5. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 222.6 bits 970,  Expect = 4e-60
 Identities = 152/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 222.6 bits 970,  Expect = 4e-60
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 222.4 bits 969,  Expect = 5e-60
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGS++KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 222.4 bits 969,  Expect = 5e-60
 Identities = 152/160 95%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAIS VENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 221.7 bits 966,  Expect = 8e-60
 Identities = 152/160 95%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFKFVKERVDEVDNANFK+SYTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 221.5 bits 965,  Expect = 9e-60
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 219.9 bits 958,  Expect = 3e-59
 Identities = 150/160 93%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAE+MKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 219.7 bits 957,  Expect = 3e-59
 Identities = 150/160 93%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFKFVKERVDEVDNANFK++YTVIEGDVLGD LEKVS EL IVAAPGGGSI+KIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 13. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 218.6 bits 952,  Expect = 6e-59
 Identities = 150/159 94%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GSPFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS KF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 14. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 214.6 bits 934,  Expect = 1e-57
 Identities = 147/159 92%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSV+PAARLFKSYVLD DKLIPKVAPQ ISSVENVGGNGGPGTIKNITFAE
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            G PFKFVKERVDEVDNANFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS KF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAE+MKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 15. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 210.4 bits 915,  Expect = 2e-56
 Identities = 142/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K+VKERVDEVDN NFK+SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 16. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 209.1 bits 909,  Expect = 5e-56
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSV+ AARLFKSYVLD DKLIPKVAPQAI+SVENVGGNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K+VKERVDEVDN NFK+SYTVIEGDVLGDKLEKV  EL IVAAPGGGS LKIS K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 17. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 208.9 bits 908,  Expect = 5e-56
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ETPSV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 18. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 207.3 bits 901,  Expect = 2e-55
 Identities = 140/159 88%, Positives = 148/159 93%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE ETPSV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS KF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 19. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 206.5 bits 897,  Expect = 3e-55
 Identities = 140/160 87%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FHAKGDHE+NAEE+KGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 200.1 bits 868,  Expect = 2e-53
 Identities = 134/159 84%, Positives = 149/159 93%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAET SV+PAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GSP K+VKERV+E+D+ NFK++YTVIEGDVLGDKLEKVS EL IVAAPGGGSI+KIS KF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            HAKG HEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 182.2 bits 787,  Expect = 6e-48
 Identities = 119/160 74%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAETPSV+PAARLFK+++LD DKL+PKVAP+A+SSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD  NFK+S++VIEG  +GD LEKV  E+ IVAAP GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            FH KGDHE+NAE++K  KE A  LL+AVESYLLAH+  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 181.3 bits 783,  Expect = 1e-47
 Identities = 119/160 74%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ +VA P GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE AE LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 181.1 bits 782,  Expect = 1e-47
 Identities = 119/160 74%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SV+PAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 180.6 bits 780,  Expect = 2e-47
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYEAETPSV+PAARLFK+++LD DKL+PKVAP+A+SSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GSPFK+VKERVDEVD  NFK+S++VIEG  +GD LEKV  E+ IVAAP GGSILKIS KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHE+NAE++K  KE A  LL+AVESYLLAH+  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 25. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 180.4 bits 779,  Expect = 2e-47
 Identities = 118/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SV+PAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP K+VKERV+EVD+ NFK+SYTVIEG  +GDK+EK+  E+ IVAAP GGSILKI+ K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 26. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 179.5 bits 775,  Expect = 4e-47
 Identities = 118/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 179.5 bits 775,  Expect = 4e-47
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYEAET SV+PAARLFK+++LD + LIPKVAPQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP K+VKERV+EVD+ NFK+SYTVIEG  +GDK+EK+  E+ IVAAP GGSILKI+ K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 179.3 bits 774,  Expect = 4e-47
 Identities = 118/160 73%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 178.9 bits 772,  Expect = 6e-47
 Identities = 117/159 73%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE+ET SV+PAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ +VA P GGSILKIS K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 30. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 178.9 bits 772,  Expect = 6e-47
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E+ SV+PAARLFK+++LD + LIPKVAPQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERV+EVD+ NFK+SYTVIEG  +GDK+EK+  E+ IVAAP GGSILKIS K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV+AE +KG KE  E L+RAVE+YLLAH+  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 178.9 bits 772,  Expect = 6e-47
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GGSILKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 177.8 bits 767,  Expect = 1e-46
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GGSILKIS K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 177.8 bits 767,  Expect = 1e-46
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GGSILKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 177.5 bits 766,  Expect = 2e-46
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GGSILKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 177.5 bits 766,  Expect = 2e-46
 Identities = 117/160 73%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD+E+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 177.3 bits 765,  Expect = 2e-46
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GGSILKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 176.9 bits 763,  Expect = 2e-46
 Identities = 114/160 71%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK+SY+VIEG  +GD LEK+S E+ IVA P GGSILKI+ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 176.6 bits 762,  Expect = 3e-46
 Identities = 114/160 71%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK+SY+VIEG  +GD LEK+S E+ IVA P GGSILKI+ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 176.0 bits 759,  Expect = 4e-46
 Identities = 114/159 71%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVFNYE E  SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            G PFK+VK+RVDEVD+ANFK+SY++IEG  +GD LEK+S E+ IVA P GGSILKIS K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 40. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 175.8 bits 758,  Expect = 5e-46
 Identities = 114/160 71%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK RVDEVD+ NFK+SY+VIEG  +GD LEK+S E+ IVA P GGSILKI+ K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 174.9 bits 754,  Expect = 9e-46
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 174.9 bits 754,  Expect = 9e-46
 Identities = 111/160 69%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PAAR+FK+++LD DKL+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 174.9 bits 754,  Expect = 9e-46
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L+PKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 174.7 bits 753,  Expect = 1e-45
 Identities = 113/160 70%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ +VA P GGSIL+IS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 174.7 bits 753,  Expect = 1e-45
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 174.4 bits 752,  Expect = 1e-45
 Identities = 112/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 174.2 bits 751,  Expect = 1e-45
 Identities = 112/160 70%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE+ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 174.0 bits 750,  Expect = 2e-45
 Identities = 114/160 71%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG PFK+VK+RVDEV + NFK+SY+VIEG  +GD LEK+S E+ IVA P G SILKIS K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 172.9 bits 745,  Expect = 4e-45
 Identities = 111/160 69%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
             G PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG +LKIS K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 168.9 bits 727,  Expect = 5e-44
 Identities = 111/150 74%, Positives = 127/150 84%, Gaps = 0/150 0%
Query  4    FNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGS 63
            FNYE+ET SV+PAARLFK+++L+ D LIPKVAPQAISSVEN+ GNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKFHA 123
            PFK+VKERVDEVD+ANFK+SY++IEG  LGD LEK+  E+ IVA P GGSILKIS K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVNAEEMKGAKEMAEKLLRAVESYLL 153
            KGDHE+ AE MK  KE  E LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 162.8 bits 699,  Expect = 4e-42
 Identities = 105/150 70%, Positives = 125/150 83%, Gaps = 0/150 0%
Query  4    FNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGS 63
            FNYE ET SV+PAARLFK+++LD D L PKVAPQAISSV+N+ GNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKFHA 123
            PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ IVA P GG ILKIS K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVNAEEMKGAKEMAEKLLRAVESYLL 153
            KG+HEV AE++K +KEM E LLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 161.4 bits 693,  Expect = 1e-41
 Identities = 104/160 65%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+  ARLFKS+VLD D LIPKVAP+ +SS EN+ GNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS FK++K RVDE+D+ANFK+ Y++IEG  LGD LEK+S E+ IVAAPGGGSILKI+ K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD  +N EE+K  KE    L++AVE+YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 158.3 bits 679,  Expect = 9e-41
 Identities = 100/160 62%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+P ARLFK +VLD D LIPKVAP+AI S+E + GNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSPF ++K++V+E+D ANF + Y+VIEGD L DKLEK++ E+ IVA+P GGSILK   K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H  GDHE+  E++K  KE A  L++AVE YLLAH+  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 152.6 bits 653,  Expect = 5e-39
 Identities = 99/159 62%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SV+P ARLFKS+VLD D LIPKVAPQ  +S EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAP-GGGSILKISG 119
            EG+ FK++K +V+E+D+ANFK+ Y++IEG  LG  LEK+S E+ + AAP GGGSILKI+ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  +N EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 151.9 bits 650,  Expect = 8e-39
 Identities = 98/159 61%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SV+P ARLFKS+VLD D LIPKVAPQ  +S EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAP-GGGSILKISG 119
            EG+ FK++K +V+E+D+ANFK+ Y++IEG  LG  LEK+  E+ + AAP GGGSILKI+ 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  +N EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 151.7 bits 649,  Expect = 9e-39
 Identities = 98/159 61%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF+YE E  SV+P ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAP-GGGSILKISG 119
            EGS FK++K +V+E+D+ANFK+ Y++IEG  LG  LEK+S E+ + AAP GGGSILKI+ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  ++ EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 151.0 bits 646,  Expect = 1e-38
 Identities = 98/159 61%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SV+P ARLFKS+VLD D LIPKVAPQ  +  EN+ GNGGPGTIK ITFA
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAP-GGGSILKISG 119
            EGS FK++K +V+E+D+ANFK+ Y++IEG  LG  LEK+S E+ + AAP GGGSILKI+ 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            K+H KG+  ++ EE+K  KE A  L++AVE+YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 150.6 bits 644,  Expect = 2e-38
 Identities = 96/160 60%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E+ SV+P ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK I F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K+VK R D +D ANF ++Y+VIEGD L DK+EK+S E  IVA+  GGSILK    
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H+KGDHE+  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 59. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 149.3 bits 638,  Expect = 5e-38
 Identities = 93/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+ET +V+  ARLFK++VLD D LIPKVAPQAI S E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS F +VK R+DE+DNANF ++ T+IEGD + + LEK++ E+ +VA+P GGSILK + K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGDHE+  +++K  KE A  +++AVE+YLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 60. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 149.0 bits 637,  Expect = 6e-38
 Identities = 94/160 58%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +P  RLFK++VLD D LIPK+AP+AI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS FK+VK R+DE+D ANF + Y+VIEGDV+ + LEK+S E+ IVA+P GGSILK + K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG++E+  E++   KE A  L++AVE+YLLAH+  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 146.4 bits 625,  Expect = 4e-37
 Identities = 90/160 56%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE ET SV+PA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK+RV+ +D  NF +SY++IEGD L DKLEK++ E  ++A+P GGSI+K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 143.5 bits 612,  Expect = 3e-36
 Identities = 88/160 55%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PA RLFK+++LD D LIPK+APQAI S + + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK+RV+ +D  NF +SY++IEGD L DKLEK++ E  ++A+P GGSI+K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 142.6 bits 608,  Expect = 5e-36
 Identities = 88/160 55%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+PA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK+RV+ +D  NF +SY++IEGD L DKLEK++ E  ++A+P GGSI+K +  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            + AKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 141.3 bits 602,  Expect = 1e-35
 Identities = 91/159 57%, Positives = 118/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SV+P ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K  K R+D +D  NF +S++VIEGD L DKLE VS E  IVA+P GGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A ++++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 138.7 bits 590,  Expect = 8e-35
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  YE+E  SV+P ARLFK++VLD D LIPKV PQA+ S E + GNGGPGTIK ITF 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K  K R+D +D  NF FS++VIEGD L DKLE VS E  IVA+P GGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 66. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 138.4 bits 589,  Expect = 9e-35
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S +P  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D +D  N  +SYT+IEGD LGD LEK+S E  +VA+P GGSI+K +  
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 138.0 bits 587,  Expect = 1e-34
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S +P  RLFK++VLD D L+PK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D +D  N+ +SYT+IEGD LGD LEK+S E  +VA+P GGSI+K +  
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 68. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 133.4 bits 566,  Expect = 3e-33
 Identities = 81/160 50%, Positives = 111/160 69%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP GG+I+K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 69. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 132.9 bits 564,  Expect = 4e-33
 Identities = 79/160 49%, Positives = 111/160 69%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP GG+++K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 70. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 132.7 bits 563,  Expect = 5e-33
 Identities = 83/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVFNYE E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VA+ G GS++K +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H K D E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 132.0 bits 560,  Expect = 7e-33
 Identities = 79/160 49%, Positives = 111/160 69%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++  +D  N  +SY++IEGD L + +EK+  E  +V+AP GG+I+K + K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 131.8 bits 559,  Expect = 9e-33
 Identities = 83/159 52%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VAA G GS++K +  
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 73. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 131.4 bits 557,  Expect = 1e-32
 Identities = 80/160 50%, Positives = 110/160 68%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG + YE E  S +PA +LFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP GG+I+K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 74. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 131.4 bits 557,  Expect = 1e-32
 Identities = 81/160 50%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SV+P  +LFK+++LD D LIPKVAP A+   E + G+GG GTIK +TF 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK RVD +D  N+ +SYT+IEGD L D +E ++ ++ +VA+P GGSI+K +  
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E++K  KE A  L++ VE+YLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 75. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 131.2 bits 556,  Expect = 1e-32
 Identities = 82/159 51%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VA+ G GS++K +  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 76. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 130.7 bits 554,  Expect = 2e-32
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SV+  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS +K  K R+D +D  NF +S++VIEGD L DKLE VS E  IVA+P GGSI K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E ++G KE A  +++AVE+YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 130.3 bits 552,  Expect = 3e-32
 Identities = 84/159 52%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 130.3 bits 552,  Expect = 3e-32
 Identities = 84/159 52%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 130.1 bits 551,  Expect = 3e-32
 Identities = 84/159 52%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK +VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 129.4 bits 548,  Expect = 5e-32
 Identities = 83/159 52%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  ++A+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 129.0 bits 546,  Expect = 6e-32
 Identities = 83/159 52%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ES+L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 129.0 bits 546,  Expect = 6e-32
 Identities = 83/159 52%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGT K ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 129.0 bits 546,  Expect = 6e-32
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 128.7 bits 545,  Expect = 7e-32
 Identities = 84/158 53%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GV+ YE E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
            GS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 85. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 128.7 bits 545,  Expect = 7e-32
 Identities = 79/159 49%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ YE E  S +PA +LFK++VLD D LIPK+APQA+   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++  +D  N  +SY++IEGD L D +EK+  E  +V+AP G +I+K + K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 128.5 bits 544,  Expect = 9e-32
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 128.5 bits 544,  Expect = 9e-32
 Identities = 83/159 52%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + G+GGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD AN+ ++YT+IEGD L D +EKVS E  +VA+ G GSI+K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +   KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 128.5 bits 544,  Expect = 9e-32
 Identities = 77/160 48%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG+F Y  E+ SV+P  RLFK+ VL+ D LIPK+APQ++ S E V G+GG GTIK I+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D +D  NF ++Y+++EGD L DK+EK+S E+ +VA+  GGS++K +  
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E++K  KE A  L++ +E+YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 89. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 128.1 bits 542,  Expect = 1e-31
 Identities = 82/159 51%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 90. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 127.9 bits 541,  Expect = 1e-31
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG++ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK RVD +D A++ ++YT+IEGD L D +EK+S E  +VA+ G GS +K    
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 127.6 bits 540,  Expect = 2e-31
 Identities = 82/159 51%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 92. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 127.4 bits 539,  Expect = 2e-31
 Identities = 81/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  K  A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 127.2 bits 538,  Expect = 2e-31
 Identities = 82/159 51%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 127.2 bits 538,  Expect = 2e-31
 Identities = 81/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +E +S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 127.0 bits 537,  Expect = 2e-31
 Identities = 80/159 50%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE E  SV+P ARL+ ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK ++D VD  NF + Y+VIEGD + + +EK+S E  +VA+ G GS++K    
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 126.3 bits 534,  Expect = 4e-31
 Identities = 81/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+ +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA   G +I  IS  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSIS-H 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE    L++ +ESYL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 126.3 bits 534,  Expect = 4e-31
 Identities = 82/159 51%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E  S +P +RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 98. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 126.1 bits 533,  Expect = 5e-31
 Identities = 77/160 48%, Positives = 117/160 73%, Gaps = 1/160 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF YE+E  S +  ARLFK++VLD D L+PK+APQA+  VE + GNGG GTIK ITF 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVL-GDKLEKVSLELTIVAAPGGGSILKISG 119
            +G PFK+VK +++ +D  ++ +SY++IEGD L G++LEK++ E  +VA+  GG+++K   
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            K+++ GD +VN E++K  ++ A ++L+ VE+YL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 125.0 bits 528,  Expect = 1e-30
 Identities = 83/158 52%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E++  SV+P ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E S FK+ K R+D +D  N  +S++VIEGD L D +  VS E+  VA+P GGSI K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 123.2 bits 520,  Expect = 3e-30
 Identities = 83/158 52%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E++  SV+  ARLFK+  LD D LI KV PQAI S E + GNGGPGTIK ITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E S FK+ K R+D +D  N  +S++VIEGD L   +E VS E+  VA+P GGSI+K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            ++ KGD ++  E+++ A E A  LL+AVE+YL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 101. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 123.2 bits 520,  Expect = 3e-30
 Identities = 79/159 49%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV+NYE++  SV+P ARLFK++VLD D LI KV P+A+ S E + GNGGPGTIK  TF 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E S  K+ K R+D +D  N  +S++VIEG+ L D +  +S E+  VA+P GGSI+K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            ++ KG  ++  E+++ A E    L++AVE+YLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 119.9 bits 505,  Expect = 3e-29
 Identities = 77/155 49%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y+ E PS +P  +L+K+++LD D L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS  K VK+RVD +D  N+ +SYT+IEGDVL +K+E +S  + IVA P GGSI K    
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 103. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 111.7 bits 468,  Expect = 1e-26
 Identities = 76/158 48%, Positives = 106/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +  A L+K+ V D D +IPK A  +  SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E    KFV  +++ +D AN+ +SY+V+ G  L D  EK++++  +VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +  KGD E N +E+K  K  A+ L++A+E+YLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 104. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 111.1 bits 465,  Expect = 2e-26
 Identities = 68/159 42%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +  E+ + +   RLFK  VLDFD L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE ++ ++   AA  GG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 109.6 bits 458,  Expect = 4e-26
 Identities = 66/134 49%, Positives = 97/134 72%, Gaps = 1/134 0%
Query  12   SVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAEGSPFKFVKER 71
            SV+P  +LFK++VLD D LIPK+APQA+ SVE + G+GG GT+K I + EG+   +VK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKFHAKGDHEVNA 131
            +D +D  NF +SY++ EGD LGDK+EK+S E+ +VA+ G GSI+K +  +H KG  E+  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EEMKGAKEMAEKLLR 146
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 109.5 bits 458,  Expect = 4e-26
 Identities = 64/159 40%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + +   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE ++ ++   A   GG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGDH V+ EE    +E    + +AVE+YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 107.8 bits 450,  Expect = 1e-25
 Identities = 72/154 46%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG   Y+ E PS + A ++FK++VLD D +IPK  P+AI+ V+ + G+GG GTIK  TF 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGS  K VK R+D +D  NF +SY++IEG  L D +E +S  + IVA P GG I K    
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +  K D +V+ EE+K  KE A  +++ VE+YLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 106.2 bits 443,  Expect = 4e-25
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E    KFV  +++E+D AN+ +SY+++ G  L D  EK+S++  +   P GGS++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +E+K  K  ++ L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 105.6 bits 440,  Expect = 7e-25
 Identities = 65/155 41%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E    KFV  +++ +D AN+ +SY+++ G  L +  EK++++  +   P GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 110. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 104.7 bits 436,  Expect = 1e-24
 Identities = 67/157 42%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E    KF+  +V+ +D AN+ ++Y+V+ G  L    EK+++E  +V  P GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 104.0 bits 433,  Expect = 2e-24
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
                KFV  +++ +D AN+ +SY+++ G  L +  EK++++  +   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 100.0 bits 415,  Expect = 4e-23
 Identities = 58/142 40%, Positives = 92/142 64%, Gaps = 1/142 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  Y  E+ + +   RLFK+ VLDFD L+PK+  Q + + E + G+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EG P K++K ++  +D+ N++  Y++IEGD+LG+KLE ++ ++   A   GG + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEVNAEEMK-GAKEMAE 142
            +H KGDH V+ EE   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 96.7 bits 400,  Expect = 3e-22
 Identities = 63/154 40%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M VF ++ +  S +  A L+ +   D D +IPK A  +  SVE V GNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E    KFV  +++ VD AN+ +SY+++ G  L D  EK++++  I     GGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            +H KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 96.1 bits 397,  Expect = 5e-22
 Identities = 63/153 41%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +E E+ S +P A+LFK+ V+D D+L PK+ P AI S+E V GNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E     +V  ++D +D A + + YT+  G  + + LEKVS++  + AA GG  I K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKI-KVSVT 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 95.6 bits 395,  Expect = 7e-22
 Identities = 61/155 39%, Positives = 96/155 61%, Gaps = 0/155 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV   E    S +PAA+LFK+  LD D L+P+V P AI   E + G+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            + SP+K +K+++D +D   F FSY++I+GD+L   ++ ++  L+ V    GG     +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            F+ KGD  V  E +K A +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 116. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 95.6 bits 395,  Expect = 7e-22
 Identities = 61/153 39%, Positives = 98/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            M V  +E  T S+ P+  +FK++V+DFD + PK  P+   S++ + G+GG GTIK+IT++
Sbjct  1    MAVAEFEI-TSSLSPSN-IFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            +G PF   K +VD +D+ NF  SYT+ EGDVL   +E  +  L  + +  GGS+ K S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            F  KGD ++  E +   KE  +K ++A+E+Y+++H
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 94.5 bits 390,  Expect = 1e-21
 Identities = 62/154 40%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV  +  E  S + A ++F+ +V+D D ++PK AP A  SVE + G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            +G P   +  R+D V+   + F Y+VI+GD+L   +E +   + +V    GGSI K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 91.9 bits 378,  Expect = 9e-21
 Identities = 63/154 40%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP   +  R D V+   + +  TVI+GD+L   +E +   L +V    GGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 91.2 bits 375,  Expect = 1e-20
 Identities = 63/154 40%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP   +  R D V+   + +  TVI+GD+L   +E +   L +V    GGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 90.6 bits 372,  Expect = 2e-20
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP   +  R D V+   + +  TVI+GD+L + +E +   + +V    GGSI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 90.5 bits 372,  Expect = 2e-20
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV     E PS + A ++++ ++LD D + PKV PQ I SVE + G+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E + +  +K++VD +D A + ++YT I GD+L D LE V  E+ +V   GG  I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGG-CIVKNTTI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 90.1 bits 370,  Expect = 3e-20
 Identities = 61/154 39%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK AP A  SV+ V G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP   +  R D V+   + +  TVI+GD+L + +E +   + +V    GGSI K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 123. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 89.4 bits 367,  Expect = 5e-20
 Identities = 58/154 37%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MGV   E E PS + A ++++ ++LD D + PKV PQ I SVE + G+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            E + +  +K++VD +D A + ++YT I GD+L + LE V  ++ +V   GG  I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGG-CIVKNTTI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 88.8 bits 364,  Expect = 8e-20
 Identities = 61/154 39%, Positives = 89/154 57%, Gaps = 1/154 0%
Query  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
            MG  ++  E  S + A ++F   VLD D +IPK A  A  SVE V G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
            EGSP   +  R D V+   + +  TVI+GD+L   +E +   + +V    GGSI K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155
            FH KGD  V  E +K A      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.1 bits 242,  Expect = 5e-12
 Identities = 42/89 47%, Positives = 58/89 65%, Gaps = 17/89 19%
Query  55   KNITFAEGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSI 114
            K ITF EGS + +VK                 +EGD L D LEK+  E  +V+AP   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160
            +K + K+H KGD E+  E +K  KE A  L++ +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 49.4 bits 183,  Expect = 2e-08
 Identities = 29/50 58%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGP 51
            GVF +E++  SV+  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 44.6 bits 164,  Expect = 1e-06
 Identities = 46/145 31%, Positives = 75/145 51%, Gaps = 15/145 10%
Query  4    FNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-AEG 62
            FN + E    + A  L+     DF  ++PKV P+ +  V+ + G+GG GTI    F  E 
Sbjct  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
Query  63   SPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLE--KVSLELTIVAAPGGGSILKISGK 120
            SP  + +E + E D ++ +    VIEG  L   L   K +++L+ +        +KIS  
Sbjct  63   SP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY- 120
Query  121  FHAKGDHEVNAEEMKGAKEMAEKLL---RAVESYLLAHTA 157
                 DH+ + EE     + ++  L   R +E YL   +A
Sbjct  121  -----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 30.7 bits 97,  Expect = 0.004
 Identities = 14/24 58%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVFNYEAETPSVMPAARLFKSYVL 25
            GVF +E++  SV+P ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 129. Allergen Name: Act d 11.0101 Sequence ID: P85524

 Score = 32.1 bits 107,  Expect = 0.009
 Identities = 28/119 23%, Positives = 55/119 46%, Gaps = 6/119 5%
Query  30   LIPKVAPQAISSVENVGGNGGP-GTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTVIE 88
            LI +++P  I  V+ + GN G  G++    +      K  K+ V+ +D      ++ ++E
Sbjct  30   LISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVE 89
Query  89   GDVLGDKLEKVSLELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKGAKEMAEKLLRAV 148
            GD++    E     + IV     G    ++  FH +   E + EE         ++ + +
Sbjct  90   GDLM----ELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKE-DVEEPNTLMNFCIEITKDI 144
Query  149  ESYLL 153
            E+Y L
Sbjct  145  ETYHL 149

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.