The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS
EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK
YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB02216 Car b 1.0301 161 1040 226.6 2.5e-61
CAB02217 Car b 1.0302 161 1018 222.0 6.1e-60
CAA96548 Cor a 1.0201 160 940 205.7 4.9e-55
P38950 Car b 1 159 860 189.0 5.3e-50
P43186 Bet v 1.0204 160 852 187.3 1.7e-49
Q39427 Bet v 1.0205 160 852 187.3 1.7e-49
P43184 Bet v 1.0203 160 845 185.9 4.7e-49
CAA54421 Bet v 1.0201 160 844 185.7 5.4e-49
AAB24432 Aln g 1 160 842 185.2 7.2e-49
CAA04828.1 Bet v 1.0206 159 840 184.8 9.6e-49
CAA54481 Bet v 1.0202 160 836 184.0 1.7e-48
P38948 Aln g 1 159 835 183.8 2e-48
CAA50325 Cor a 1.0103 160 827 182.1 6.4e-48
CAA07329.1 Bet v 1.0118 160 821 180.9 1.5e-47
CAA50328 Cor a 1.0102 160 820 180.6 1.8e-47
CAB02160 Bet v 1.0113 160 819 180.4 2e-47
CAB02161 Bet v 1.0114 160 819 180.4 2e-47
CAB02156 Bet v 1.0109 160 819 180.4 2e-47
CAB02159 Bet v 1.0112 160 818 180.2 2.3e-47
CAA33887 Bet v 1.0101 160 818 180.2 2.3e-47
CAA50327 Cor a 1.0101 160 813 179.2 4.8e-47
CAA54487 Bet v 1.0106 160 811 178.8 6.5e-47
ABZ81040 Car b 1.0109 160 811 178.8 6.5e-47
CAA54484 Bet v 1.0104 160 810 178.6 7.5e-47
CAA54489 Bet v 1.0107 160 807 177.9 1.2e-46
CAA54482 Bet v 1.0102 160 807 177.9 1.2e-46
ABZ81043 Car b 1.0112 160 807 177.9 1.2e-46
ABZ81042 Car b 1.0111 160 807 177.9 1.2e-46
Q08407 Cor a 1 159 806 177.7 1.3e-46
ADK39021 Ost c 1.0101 160 806 177.7 1.3e-46
CAA54483 Bet v 1.0103 160 806 177.7 1.3e-46
CAB02155 Bet v 1.0108 160 806 177.7 1.3e-46
ABZ81041 Car b 1.0110 160 806 177.7 1.3e-46
CAA07323.1 Bet v 1.0117 160 805 177.5 1.5e-46
CAA54485 Bet v 1.0105 160 804 177.3 1.8e-46
CAB02157 Bet v 1.0110 160 803 177.1 2.1e-46
ABZ81044 Car b 1.0113 160 803 177.1 2.1e-46
CAA04827.1 Bet v 1.0116 159 802 176.9 2.4e-46
CAB02206 Car b 1.0103 160 800 176.5 3.2e-46
ACF75030.1 Bet v 1.0207 150 797 175.8 4.6e-46
CAA96547 Bet v 1.0115 160 796 175.6 5.7e-46
CAB02158 Bet v 1.0111 160 796 175.6 5.7e-46
CAB02209 Car b 1.0106 160 795 175.4 6.6e-46
CAB02207 Car b 1.0104 160 794 175.2 7.6e-46
CAA50326 Cor a 1.0104 160 794 175.2 7.6e-46
CAA47357 Car b 1.0102 159 789 174.2 1.6e-45
CAB02213 Car b 1.0107 160 789 174.2 1.6e-45
CAB02208 Car b 1.0105 160 788 174.0 1.8e-45
CAB02215 Car b 1.0108 160 779 172.1 6.7e-45
P38949 Car b 1 159 776 171.4 1e-44
ABC41615.1 Bet v 1.0119 150 752 166.4 3.1e-43
CAA54696.1 Bet v 1.0301 160 721 159.9 3e-41
CAA96549 Cor a 1.0301 160 718 159.3 4.6e-41
CAA96535 Mal d 1.0401 160 697 154.9 9.7e-40
AAG40329 Cor a 1.0402 161 693 154.1 1.7e-39
AAG40331 Cor a 1.0404 161 690 153.5 2.7e-39
AAD48405 Cor a 1.0401 161 690 153.5 2.7e-39
AAG40330 Cor a 1.0403 161 690 153.5 2.7e-39
CAD10374 Cas s 1 160 684 152.2 6.4e-39
APD76154 Jug r 5.0101 160 681 151.6 9.8e-39
CAA96537 Mal d 1.0403 160 680 151.4 1.1e-38
CAA96536 Mal d 1.0402 160 680 151.4 1.1e-38
ACJ23864 Fag s 1.0101 160 680 151.4 1.1e-38
ABZ81046 Que a 1.0301 160 637 142.4 5.8e-36
AUH28179 Que m 1.0101 160 628 140.5 2.1e-35
O50001 Pru ar 1 160 626 140.1 2.8e-35
Q2I6V8 Pru p 1.0101 160 626 140.1 2.8e-35
O24248 Pru av 1 160 624 139.7 3.8e-35
Q3T923 Fra a 1 160 619 138.6 7.8e-35
Q256S7 Fra a 1 160 619 138.6 7.8e-35
Q256S2 Fra a 1 160 615 137.8 1.4e-34
Q256S6 Fra a 1 160 610 136.7 2.9e-34
ABZ81047 Que a 1.0401 160 609 136.5 3.3e-34
CAA96534 Mal d 1.0301 159 603 135.3 7.9e-34
Q256S4 Fra a 1 159 600 134.7 1.2e-33
AAK13027 Mal d 1.0302 159 600 134.7 1.2e-33
B6CQS9 Pru du 1.0101 160 599 134.4 1.4e-33
AAO25113 Mal d 1.0304 159 596 133.8 2.2e-33
AAB01362 Mal d 1.0201 159 586 131.7 9.3e-33
AAD26545 Mal d 1.0202 159 586 131.7 9.3e-33
QOL10866 Que ac 1.0101 159 585 131.5 1.1e-32
QGS84240 Que i 1.0101 159 583 131.1 1.4e-32
AAD26546 Mal d 1.0103 159 582 130.9 1.7e-32
AAD26548 Mal d 1.0204 159 582 130.9 1.7e-32
AAD13683 Mal d 1.0206 159 581 130.7 1.9e-32
AAK13030 Mal d 1.0207 159 580 130.5 2.2e-32
AAD26547 Mal d 1.0203 159 580 130.5 2.2e-32
AAD29671 Mal d 1.0108 159 580 130.5 2.2e-32
AFN42528 Can s 5.0101 161 580 130.5 2.2e-32
CAD32318 Mal d 1.0208 158 579 130.3 2.5e-32
AAD26552 Mal d 1.0104 159 578 130.1 3e-32
O65200 Pyr c 1 159 578 130.1 3e-32
AAD26558 Mal d 1.0205 159 578 130.1 3e-32
AAK13028 Mal d 1.0303 159 577 129.8 3.4e-32
CAA58646 Mal d 1.0101 159 576 129.6 4e-32
AAD26555 Mal d 1.0107 159 575 129.4 4.6e-32
AAD26553 Mal d 1.0105 159 574 129.2 5.3e-32
AAD26554 Mal d 1.0106 159 574 129.2 5.3e-32
AAK13029 Mal d 1.0109 159 570 128.4 9.4e-32
CAA88833 Mal d 1.0102 159 568 128.0 1.3e-31
ABZ81045 Que a 1.0201 159 557 125.7 6.2e-31
CAM31908 Act c 8.0101 159 521 118.1 1.1e-28
CAM31909 Act d 8.0101 157 505 114.8 1.1e-27
Q0Z8U9 Rub i 1.0101 137 500 113.8 2e-27
CAA42646 Gly m 4 158 492 112.1 7.6e-27
AHC08073 Sola l 4.0101 160 485 110.6 2.1e-26
NP_001275580 Sola l 4.0201 160 480 109.6 4.4e-26
AAQ91847 Ara h 8.0101 157 469 107.3 2.1e-25
CAA43636 Pha v 1 155 461 105.6 6.6e-25
CAA43637 Pha v 1 156 456 104.5 1.4e-24
P25985 Pha v 1 155 449 103.1 3.8e-24
EF436550 Ara h 8.0201 153 433 99.7 3.8e-23
Q2VU97 Vig r 1.0101 155 426 98.3 1.1e-22
CAA75803 Lyc e 4.0101 178 425 98.0 1.4e-22
P49372 Api g 1 154 407 94.3 1.6e-21
CAA67246 Pet c PR10 155 405 93.9 2.2e-21
CAB03716 Dau c 1.0104 154 385 89.7 4e-20
CAB06416 Dau c 1.0105 154 382 89.1 6.2e-20
BAA13604 Dau c 1.0102 154 381 88.9 7.1e-20
P92918 Api g 1.0201 159 380 88.7 8.6e-20
AAB01092 Dau c 1.0101 168 379 88.4 1.1e-19
AAL76932 Dau c 1.0201 154 375 87.6 1.7e-19
CAB03715 Dau c 1.0103 154 372 87.0 2.6e-19
AAB92255 Tar o RAP 157 366 85.7 6.4e-19
Q5ULZ4 Fra a 1.0101 100 265 64.7 8.8e-13
P85126 Que a 1.0101 50 203 51.9 3.2e-09
Q9ZWP8 Vig r 6.0101 155 182 47.3 2.4e-07
Q9S8Q4 Cas s 1 24 113 33.2 0.00064
P85524 Act d 11.0101 150 109 32.0 0.0091
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 226.6 bits 1040,  Expect = 3e-61
 Identities = 161/161 100%, Positives = 161/161 100%, Gaps = 0/161 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN 161
            YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN 161

Sequence Alignment: 2. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 222.0 bits 1018,  Expect = 6e-60
 Identities = 158/161 98%, Positives = 159/161 98%, Gaps = 0/161 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAETTSVIPAARLFKAFILDGN LIPKV+PQAVSSVENVEGNGGPGTIKKITFS
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSPVKYVKERVEEVDHTNFKYSYTVIEGG VGDKVEKICNEIKIVAAPDGGSILKITSK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN 161
            YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYNN 161

Sequence Alignment: 3. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 205.7 bits 940,  Expect = 5e-55
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E+TSVIPAARLFKAFILDGN LIPKV+PQAVSSVENVEGNGGPGTIKKITFS
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERVEEVDHTNFKYSYTVIEGG VGDKVEKICNEIKIVAAPDGGSILKI++K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AEHIKGGKE+VEGL++ VEAYLLAH+  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 189.0 bits 860,  Expect = 5e-50
 Identities = 133/159 83%, Positives = 146/159 91%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GSPVKYVKERVEE+DHTNFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            H KG HEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 5. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 187.3 bits 852,  Expect = 2e-49
 Identities = 127/160 79%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE+ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 187.3 bits 852,  Expect = 2e-49
 Identities = 126/160 78%, Positives = 144/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIK+VA PDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 185.9 bits 845,  Expect = 5e-49
 Identities = 126/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 185.7 bits 844,  Expect = 5e-49
 Identities = 126/160 78%, Positives = 144/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 185.2 bits 842,  Expect = 7e-49
 Identities = 127/160 79%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFKAFILDG+KL+PKV+P+AVSSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVD  NFKYS++VIEGG VGD +EK+CNEIKIVAAPDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +HTKGDHE+ AE+IK  KE+  GLLK VE+YLLAH+  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 184.8 bits 840,  Expect = 1e-48
 Identities = 125/159 78%, Positives = 144/159 90%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYE+ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIK+VA PDGGSILKI++KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            HTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 11. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 184.0 bits 836,  Expect = 2e-48
 Identities = 125/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD+E+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 183.8 bits 835,  Expect = 2e-48
 Identities = 126/159 79%, Positives = 144/159 90%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYEAET SVIPAARLFKAFILDG+KL+PKV+P+AVSSVEN+EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GSP KYVKERV+EVD  NFKYS++VIEGG VGD +EK+CNEIKIVAAPDGGSILKI++K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            HTKGDHE+ AE+IK  KE+  GLLK VE+YLLAH+  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 13. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 182.1 bits 827,  Expect = 6e-48
 Identities = 124/160 77%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAETTSVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHE+ AE IKG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 180.9 bits 821,  Expect = 2e-47
 Identities = 122/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIK+VA PDGGSIL+I++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 180.6 bits 820,  Expect = 2e-47
 Identities = 122/160 76%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVKERV+EVD+TNFKYSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 180.4 bits 819,  Expect = 2e-47
 Identities = 123/160 76%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L+PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 180.4 bits 819,  Expect = 2e-47
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 180.4 bits 819,  Expect = 2e-47
 Identities = 124/160 77%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 180.2 bits 818,  Expect = 2e-47
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGGSILKI++K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 180.2 bits 818,  Expect = 2e-47
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 21. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 179.2 bits 813,  Expect = 5e-47
 Identities = 121/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 178.8 bits 811,  Expect = 6e-47
 Identities = 124/160 77%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKYSY+VIEGG VGD +EKI NEIKIVA P+GGSILKI +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 178.8 bits 811,  Expect = 6e-47
 Identities = 122/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 178.6 bits 810,  Expect = 7e-47
 Identities = 124/160 77%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKYSY+VIEGG VGD +EKI NEIKIVA P+GGSILKI +K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 177.9 bits 807,  Expect = 1e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPAAR+FKAFILDG+KL+PKV+PQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 177.9 bits 807,  Expect = 1e-46
 Identities = 121/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L+PKV+PQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 177.9 bits 807,  Expect = 1e-46
 Identities = 121/160 75%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 28. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 177.9 bits 807,  Expect = 1e-46
 Identities = 121/160 75%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 29. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 177.7 bits 806,  Expect = 1e-46
 Identities = 120/159 75%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 30. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 177.7 bits 806,  Expect = 1e-46
 Identities = 121/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+S VENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 177.7 bits 806,  Expect = 1e-46
 Identities = 124/160 77%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK RV+EVDHTNFKYSY+VIEGG VGD +EKI NEIKIVA P+GGSILKI +K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 177.7 bits 806,  Expect = 1e-46
 Identities = 121/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 177.7 bits 806,  Expect = 1e-46
 Identities = 120/160 75%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGS++KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 177.5 bits 805,  Expect = 2e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 177.3 bits 804,  Expect = 2e-46
 Identities = 121/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 177.1 bits 803,  Expect = 2e-46
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 177.1 bits 803,  Expect = 2e-46
 Identities = 121/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P K+VKERV+EVD+ NFKYSYTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 176.9 bits 802,  Expect = 2e-46
 Identities = 121/159 76%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYE E TSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            G P KYVK+RV+EVDH NFKYSY++IEGG VGD +EKI NEIKIVA PDGGSILKI++KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            HTKGDHEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 39. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 176.5 bits 800,  Expect = 3e-46
 Identities = 120/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 175.8 bits 797,  Expect = 5e-46
 Identities = 119/150 79%, Positives = 137/150 91%, Gaps = 0/150 0%
Query  4    FNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGS 63
            FNYE+ETTSVIPAARLFKAFIL+G+ LIPKV+PQA+SSVEN+EGNGGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKYHT 123
            P KYVKERV+EVDH NFKYSY++IEGG +GD +EKICNEIKIVA PDGGSILKI++KYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVPAEHIKGGKERVEGLLKPVEAYLL 153
            KGDHE+ AEH+K  KE+ E LL+ VE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 41. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 175.6 bits 796,  Expect = 6e-46
 Identities = 122/160 76%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P KYVK+RV+EV H NFKYSY+VIEGG +GD +EKI NEIKIVA PDG SILKI++K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 175.6 bits 796,  Expect = 6e-46
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
             G P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIKIVA PDGG +LKI++K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+HEV AE++K  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 175.4 bits 795,  Expect = 7e-46
 Identities = 120/160 75%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 175.2 bits 794,  Expect = 8e-46
 Identities = 119/160 74%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GD +EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHT EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 175.2 bits 794,  Expect = 8e-46
 Identities = 119/160 74%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ET SVI AARLFK+++LDG+KLIPKV+PQA++SVENV GNGGPGTIK ITF 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVKERV+EVD+TNFKYSYTVIEG  +GDK+EK+C+E+KIVAAP GGS LKI+SK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 46. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 174.2 bits 789,  Expect = 2e-45
 Identities = 119/159 74%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQA+SSVENV GNGGPGTIK ITF+E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            H KG HEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 47. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 174.2 bits 789,  Expect = 2e-45
 Identities = 120/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFK+SYTVIEG  +GDK+EK+  E+KIVAAP GGSILKI+ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 48. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 174.0 bits 788,  Expect = 2e-45
 Identities = 119/160 74%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SVIPAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHT EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 49. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 172.1 bits 779,  Expect = 7e-45
 Identities = 118/160 73%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYEAET SV+PAARLFK+++LD +KLIPKV+PQA+SSVENV GNGGPGTIK ITF+
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP K+VKERV+EVD+ NFK+SYTVIEG  +GDK+EK+  E+ IVAAP GGSILKI+ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +H KGDHEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 50. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 171.4 bits 776,  Expect = 1e-44
 Identities = 117/159 73%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVFNYEAET SVIPAARLFK+++LDG+KLIPKV+PQ +SSVENV GNGGPGTIK ITF+E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            G P K+VKERV+EVD+ NFKY+YTVIEG  +GDK+EK+ +E+KIVAAP GGSI+KI+SK+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            H KG HEV AE +KG KE  E LL+ VE+YLLAHTAEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 166.4 bits 752,  Expect = 3e-43
 Identities = 114/150 76%, Positives = 131/150 87%, Gaps = 0/150 0%
Query  4    FNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGS 63
            FNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSV+N+EGNGGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKYHT 123
            P KYVK+RV+EVDHTNFKY+Y+VIEGG VGD +EKI NEIKIVA PDGG ILKI++KYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVPAEHIKGGKERVEGLLKPVEAYLL 153
            KG+HEV AE++K  KE  E LL+ VE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 159.9 bits 721,  Expect = 3e-41
 Identities = 111/160 69%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVI  ARLFK+F+LD + LIPKV+P+ VSS EN+EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KY+K RV+E+DH NFKY Y++IEGG +GD +EKI  EIKIVAAP GGSILKITSK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD  +  E IK GKE+  GL+K VE YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 159.3 bits 718,  Expect = 5e-41
 Identities = 107/160 66%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIP ARLFK F+LD + LIPKV+P+A+ S+E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP  Y+K++VEE+D+ NF Y Y+VIEG  + DK+EKI  EIKIVA+P GGSILK  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHT GDHE+  E+IK GKE+  GL+K VE YLLAH+  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 154.9 bits 697,  Expect = 1e-39
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE ETTSVIPA RLFKAFILDG+ LIPK++PQA+ S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YH KGD E+  EH+K GKE+  GL+K +EAYLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 154.1 bits 693,  Expect = 2e-39
 Identities = 106/159 66%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF+YE E TSVIP ARLFK+F+LD + LIPKV+PQ  +  EN+EGNGGPGTIKKITF+
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGG-SILKITS 119
            EGS  KY+K +VEE+DH NFKY Y++IEGG +G  +EKI  EIK+ AAP GG SILKITS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            KYHTKG+  +  E IK GKE+  GL+K VEAYLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 153.5 bits 690,  Expect = 3e-39
 Identities = 106/159 66%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF+YE E TSVIP ARLFK+F+LD + LIPKV+PQ  +S EN+EGNGGPGTIKKITF+
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGG-SILKITS 119
            EG+  KY+K +VEE+DH NFKY Y++IEGG +G  +EKI  EIK+ AAP GG SILKITS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            KYHTKG+  +  E IK GKE+  GL+K VEAYLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 153.5 bits 690,  Expect = 3e-39
 Identities = 106/159 66%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE E TSVIP ARLFK+F+LD + LIPKV+PQ  +S EN+EGNGGPGTIKKITF+
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGG-SILKITS 119
            EG+  KY+K +VEE+DH NFKY Y++IEGG +G  +EKI  EIK+ AAP GG SILKITS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            KYHTKG+  +  E IK GKE+  GL+K VEAYLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 153.5 bits 690,  Expect = 3e-39
 Identities = 106/159 66%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE E TSVIP ARLFK+F+LD + LIPKV+PQ  +  EN+EGNGGPGTIKKITF+
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGG-SILKITS 119
            EGS  KY+K +VEE+DH NFKY Y++IEGG +G  +EKI  EIK+ AAP GG SILKITS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            KYHTKG+  +  E IK GKE+  GL+K VEAYLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 59. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 152.2 bits 684,  Expect = 6e-39
 Identities = 102/160 63%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E E TS IP  RLFKAF+LD + LIPK++P+A+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVK R++E+D+ NF Y Y+VIEG  V + +EKI  EIKIVA+PDGGSILK TSK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG++E+  E +  GKE+  GL+K VEAYLLAH+  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 151.6 bits 681,  Expect = 1e-38
 Identities = 103/160 64%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE E+TSVIP ARLFKAF+LD + LIPKV PQAV S E +EGNGGPGTIKKI F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  KYVK R + +D  NF Y+Y+VIEG  + DK+EKI  E KIVA+ +GGSILK  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YH+KGDHE+  E +K GKE+  GL+K VE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 151.4 bits 680,  Expect = 1e-38
 Identities = 101/160 63%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPA RLFKAFILDG+ LIPK++PQA+ S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K TS 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            Y  KGD E+  EH+K GKE+  GL+K +EAYLLAH+  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 151.4 bits 680,  Expect = 1e-38
 Identities = 100/160 62%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIPA RLFKAFILDG+ LIPK++PQA+ S + +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K  S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YH KGD E+  EH+K GKE+  GL+K +EAYLLAH+  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 151.4 bits 680,  Expect = 1e-38
 Identities = 102/160 63%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+ETT+VI  ARLFKAF+LD + LIPKV+PQA+ S E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++E+D+ NF Y+ T+IEG  + + +EKI  EIK+VA+PDGGSILK TSK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGDHE+  ++IK GKE   G++K VEAYLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 142.4 bits 637,  Expect = 6e-36
 Identities = 97/159 61%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E  SVIP ARLFKAF+LD + LIPKV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS +K+ K R++ +D  NF YS++VIEG  + DK+E +  E KIVA+PDGGSI+K TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            Y+TKGD ++  E I+GGKE+   ++K VEAYL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 140.5 bits 628,  Expect = 2e-35
 Identities = 95/159 59%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  YE+E  SVIP ARLFKAF+LD + LIPKV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS +K+ K R++ +D  NF +S++VIEG  + DK+E +  E KIVA+PDGGSI+K T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            Y+TKGD ++  E I+GGKE+  G++K VEAYL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 66. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 140.1 bits 626,  Expect = 3e-35
 Identities = 97/160 60%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE E TSVIP  +LFKAFILD + LIPKV+P AV   E +EG+GG GTIKK+TF 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK RV+ +D  N+ YSYT+IEG  + D +E I  +IK+VA+PDGGSI+K TS 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  E++K GKE+  GL+K VEAYLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 67. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 140.1 bits 626,  Expect = 3e-35
 Identities = 92/160 57%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E TS IP  RLFKAF+LD + L+PK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ +D  N  YSYT+IEG  +GD +EKI  E K+VA+P GGSI+K TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 68. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 139.7 bits 624,  Expect = 4e-35
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E TS IP  RLFKAF+LD + L+PK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ +D  N+ YSYT+IEG  +GD +EKI  E K+VA+P GGSI+K TS 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+   L+K +E YL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 69. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 138.6 bits 619,  Expect = 8e-35
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+++K TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 70. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 138.6 bits 619,  Expect = 8e-35
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+I+K TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 137.8 bits 615,  Expect = 1e-34
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + + +EKI  E K+V+AP GG+I+K TSK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 136.7 bits 610,  Expect = 3e-34
 Identities = 90/160 56%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG + YE E TS IPA +LFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP GG+I+K TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 73. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 136.5 bits 609,  Expect = 3e-34
 Identities = 94/159 59%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS +K+ K R++ +D  NF YS++VIEG  + DK+E +  E KIVA+PDGGSI K TSK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            Y+TKGD ++  E I+GGKE+  G++K VEAYL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 135.3 bits 603,  Expect = 8e-34
 Identities = 93/159 58%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVFNYE E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTK D E+  EH+K GKE+   L+K +E YLLAH+  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 75. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 134.7 bits 600,  Expect = 1e-33
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ YE E TS IPA +LFKAF+LD + LIPK++PQAV   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK ++  +D  N  YSY++IEG  + D +EKI  E K+V+AP G +I+K TSK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 76. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 134.7 bits 600,  Expect = 1e-33
 Identities = 93/159 58%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VAA   GS++K TS 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 77. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 134.4 bits 599,  Expect = 1e-33
 Identities = 89/160 55%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG+F Y  E+TSVIP  RLFKA++L+ + LIPK++PQ+V S E VEG+GG GTIKKI+F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ +D  NF Y+Y+++EG  + DKVEKI  EIK+VA+ DGGS++K TS 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  E +K GKE+  GL+K +E YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 78. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 133.8 bits 596,  Expect = 2e-33
 Identities = 92/159 57%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 131.7 bits 586,  Expect = 9e-33
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 131.7 bits 586,  Expect = 9e-33
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 131.5 bits 585,  Expect = 1e-32
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+NYE++ TSVIP ARLFKAF+LD + LI KV P+AV S E +EGNGGPGTIKK TF 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E S VKY K R++ +D  N  YS++VIEG  + D +  I  E+K VA+PDGGSI+K T+K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            Y+TKG  ++  E+I+   E+  GL+K VEAYLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 82. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 131.1 bits 583,  Expect = 1e-32
 Identities = 92/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +E++ TSVIP ARLFKAF+LD + LIPKV PQA+ S+E +EGNGGPGTIKKITF 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E S  KY K R++ +D  N  YS++VIEG  + D V  +  EIK VA+PDGGSI K T+K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            Y+TKGD ++  E+I+   E++ GL K VEAYLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 83. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 130.9 bits 582,  Expect = 2e-32
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 130.9 bits 582,  Expect = 2e-32
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K++A+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 130.7 bits 581,  Expect = 2e-32
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFK F+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 130.5 bits 580,  Expect = 2e-32
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGT KKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 130.5 bits 580,  Expect = 2e-32
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E++L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 130.5 bits 580,  Expect = 2e-32
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 130.5 bits 580,  Expect = 2e-32
 Identities = 87/160 54%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE+E TS I  ARLFKAF+LDG+ L+PK++PQAV  VE +EGNGG GTIKKITF 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEG-GFVGDKVEKICNEIKIVAAPDGGSILKITS 119
            +G P KYVK ++E +D  ++ YSY++IEG  + G+++EKI +E K+VA+ DGG+++K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            KY++ GD +V  E +K G+++   +LK VEAYL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 90. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 130.3 bits 579,  Expect = 3e-32
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GV+ YE E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
            GS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            HTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 91. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 130.1 bits 578,  Expect = 3e-32
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 92. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 130.1 bits 578,  Expect = 3e-32
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG++ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK RV+ +D  ++ Y+YT+IEG  + D +EKI  E K+VA+   GS +K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 93. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 130.1 bits 578,  Expect = 3e-32
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EG+GGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  N+ Y+YT+IEG  + D +EK+  E K+VA+   GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+  GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 129.8 bits 577,  Expect = 3e-32
 Identities = 89/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF YE E TSVIP ARL+ AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK +++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 129.6 bits 576,  Expect = 4e-32
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 129.4 bits 575,  Expect = 5e-32
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GK +  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 129.2 bits 574,  Expect = 5e-32
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 129.2 bits 574,  Expect = 5e-32
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +E I  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 99. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 128.4 bits 570,  Expect = 9e-32
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA    GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 100. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 128.0 bits 568,  Expect = 1e-31
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV+ +E E TS IP +RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            YH KG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 101. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 125.7 bits 557,  Expect = 6e-31
 Identities = 89/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E S  KY K R++ +D  N  YS++VIEG  +   +E +  EIK VA+PDGGSI+K T+K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            Y+TKGD ++  E+I+   E+  GLLK VEAYL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 118.1 bits 521,  Expect = 1e-28
 Identities = 83/155 53%, Positives = 109/155 70%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  Y+ E  S +P  +L+KAFILDG+ L+PKV P+A+  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  K VK+RV+ +D  N+ YSYT+IEG  + +K E I   IKIVA PDGGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            Y TKGD +V  E IK GKE+   ++K +EAYLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 114.8 bits 505,  Expect = 1e-27
 Identities = 82/154 53%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG   Y+ E  S I A ++FKAF+LDG+ +IPK  P+A++ V+ +EG+GG GTIK  TF 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGS  K VK R++ +D  NF YSY++IEGG + D  E I   IKIVA PDGG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            Y  K D +V  E IK GKER  G++K VEAYLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 113.8 bits 500,  Expect = 2e-27
 Identities = 76/135 56%, Positives = 101/135 74%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKE 70
            TSVIP  +LFKAF+LD + LIPK++PQAV SVE +EG+GG GT+KKI + EG+   YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKYHTKGDHEVP 130
            +++ +D  NF YSY++ EG  +GDK+EKI  EIK+VA+   GSI+K TS YH KG  E+ 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  AEHIKGGKERVEGLLK 146
             E++K GKER  GL+K
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 112.1 bits 492,  Expect = 8e-27
 Identities = 79/158 50%, Positives = 106/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E E  S +  A L+KA++ D + +IPK    +  SVENVEGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E    K+V  ++E +D  N+ YSY+V+ G  + D  EKI  + K+VA P+GGS  K+T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            Y TKGD E   + +K GK + + L+K +EAYLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 110.6 bits 485,  Expect = 2e-26
 Identities = 72/159 45%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  Y  E+T+ I   RLFKA++LD + L+PK+  Q V + E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P+KY+K ++  +D  N++  Y++IEG  +G+K+E I  +IK  A  +GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            YHTKGDH V  E    G+ER+  + K VEAYLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 109.6 bits 480,  Expect = 4e-26
 Identities = 72/159 45%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +  E+T+ I   RLFK ++LD + L+PK+  + V S+E VEG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P+KY+K ++  +D  N+   Y++IEG  +GDK+E I  ++K  AA DGG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            YHTKGDH V  E    GK +   L+K +EAYLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 107.3 bits 469,  Expect = 2e-25
 Identities = 74/157 47%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E E TS +P A+L+ A + D + + PK+    V SVE VEGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E    K++  +VE +D  N+ Y+Y+V+ G  +    EKI  E K+V  P+GGSI K+T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159
            YHTKGD +   E +K GK + EGL++ +E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 105.6 bits 461,  Expect = 7e-25
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            M VF +E +TTS +  A L+KA++ D + ++PK    +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E    K+V  ++EE+D  N+ YSY+++ G  + D  EKI  + K+   P+GGS++K++ K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            YH+KGD     + +K GK + + L+K +EAYLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 104.5 bits 456,  Expect = 1e-24
 Identities = 69/155 44%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E    K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            YH+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 103.1 bits 449,  Expect = 4e-24
 Identities = 68/154 44%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
            GVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
                K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            H+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 99.7 bits 433,  Expect = 4e-23
 Identities = 65/153 42%, Positives = 104/153 67%, Gaps = 2/153 1%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +E E+TS +P A+LFKA ++DG++L PK+ P A+ S+E VEGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E     YV  +++ +D   + Y YT+  G    + +EK+  + K+ AA DGGS +K++  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  +P E  +  K++ +G++K +E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 98.3 bits 426,  Expect = 1e-22
 Identities = 69/154 44%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            M VF ++ + TS +  A L+ A+  D + +IPK    +  SVE VEGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E    K+V  ++E VD  N+ YSY+++ G  + D  EKI  + KI    DGGS++K+T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            YH KGD     + +K GK + + L+K VEAYLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 98.0 bits 425,  Expect = 1e-22
 Identities = 64/142 45%, Positives = 95/142 66%, Gaps = 1/142 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  Y  E+T+ I   RLFKA++LD + L+PK+  Q V + E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EG P+KY+K ++  +D  N++  Y++IEG  +G+K+E I  +IK  A  +GG + K T++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVPAE-HIKGGKERVE 142
            YHTKGDH V  E H  G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 115. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 94.3 bits 407,  Expect = 2e-21
 Identities = 63/154 40%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV  +  E TS + A ++F+ F++D + ++PK +P A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            +G P+  +  R++ V+   + + Y+VI+G  +   +E I N + +V   DGGSI K T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK   E+   L+K +EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 93.9 bits 405,  Expect = 2e-21
 Identities = 63/155 40%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV   E   TS +PAA+LFKA+ LD + L+P+V P A+   E +EG+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            + SP K +K++++ +D   F +SY++I+G  +   ++ I N +  V   DGG     T+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            ++TKGD  VP E+IK   ++   ++K VEAYLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 89.7 bits 385,  Expect = 4e-20
 Identities = 63/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG  ++  E TS + A ++F   +LD + +IPK +P A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP+  +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK   E+   L+K +EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 89.1 bits 382,  Expect = 6e-20
 Identities = 63/154 40%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG  ++  E TS + A ++F   +LD + +IPK +P A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP+  +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 88.9 bits 381,  Expect = 7e-20
 Identities = 62/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG  ++  E TS + A ++F   +LD + +IPK +P A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP+  +  R + V+   + Y  TVI+G  + + +E I   + +V   DGGSI K T+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 88.7 bits 380,  Expect = 9e-20
 Identities = 61/154 39%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV     E  S + A ++++ F+LD + + PKV PQ + SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E +    +K++V+ +D   + Y+YT I G  + D +E + NE  +V   DGG I+K T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            Y+TKGD  +P + IK   E+    +K VEAYLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 88.4 bits 379,  Expect = 1e-19
 Identities = 62/154 40%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG  ++  E TS + A ++F   +LD + +IPK +P A  SV+ V+G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP+  +  R + V+   + Y  TVI+G  + + +E I   + +V   DGGSI K T+ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 122. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 87.6 bits 375,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MGV   E E  S + A ++++ F+LD + + PKV PQ + SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E +    +K++V+ +D   + Y+YT I G  + + +E + N+  +V   DGG I+K T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            Y+TKGD  +P + +K   E+    +K VEAYLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 87.0 bits 372,  Expect = 3e-19
 Identities = 62/154 40%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
            MG  ++  E TS + A ++F   +LD + +IPK +  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            EGSP+  +  R + V+   + Y  TVI+G  +   +E I   + +V   DGGSI K T+ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
            +HTKGD  VP E+IK    +   L+K +EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 124. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 85.7 bits 366,  Expect = 6e-19
 Identities = 53/149 35%, Positives = 91/149 61%, Gaps = 0/149 0%
Query  7    EAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVK 66
            E E TS +  + +FKAF++D + + PK  P+   S++ +EG+GG GTIK IT+S+G P  
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKYHTKGD 126
              K +V+ +D  NF  SYT+ EG  +   +E   + +K + + DGGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEVPAEHIKGGKERVEGLLKPVEAYLLAH 155
             ++  E++   KE ++  +K +E Y+++H
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 64.7 bits 265,  Expect = 9e-13
 Identities = 48/89 53%, Positives = 62/89 69%, Gaps = 17/89 19%
Query  55   KKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSI 114
            KKITF EGS                 +Y Y  +EG  + D +EKI  E K+V+AP   +I
Sbjct  12   KKITFGEGS-----------------QYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKITSKYHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160
            +K TSKYHTKGD E+  EH+K GKE+   L+K +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 51.9 bits 203,  Expect = 3e-09
 Identities = 31/50 62%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGP 51
            GVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 47.3 bits 182,  Expect = 2e-07
 Identities = 45/148 30%, Positives = 73/148 49%, Gaps = 9/148 6%
Query  4    FNYEAETTSVIPA--ARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITF-S 60
            FN + E +  + A  A L K FI     ++PKV P+ V  V+ +EG+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
            E SP  Y +E + E D ++ +    VIEGG++   +       K+    +  +++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTA 157
            Y    D E      K  +  +   L+ +E YL   +A
Sbjct  120  YDHDSDIEEKVTPTKTSQSTLM-YLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.2 bits 113,  Expect = 0.0006
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYEAETTSVIPAARLFKAFIL 25
            GVF +E++ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 129. Allergen Name: Act d 11.0101 Sequence ID: P85524

 Score = 32.0 bits 109,  Expect = 0.009
 Identities = 34/116 29%, Positives = 55/116 47%, Gaps = 12/116 10%
Query  30   LIPKVSPQAVSSVENVEGNGGP-GTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTVIE 88
            LI ++SP  +  V+ +EGN G  G++    ++     K  K+ VE +D      ++ ++E
Sbjct  30   LISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVE 89
Query  89   GGFVGDKVEKICNEIKIVAAPDGGSILKITSKYH---TKGDHEVPAEHIKGGKERVEGLL 145
            G    D +E     I IV     G    +T  +H    K D E P   +    E    + 
Sbjct  90   G----DLMELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVEEPNTLMNFCIE----IT 141
Query  146  KPVEAYLL 153
            K +E Y L
Sbjct  142  KDIETYHL 149

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.