The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK
YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA96547 Bet v 1.0115 160 1030 233.1 2.7e-63
CAA33887 Bet v 1.0101 160 1001 226.8 2.2e-61
CAB02156 Bet v 1.0109 160 1000 226.6 2.6e-61
CAB02159 Bet v 1.0112 160 994 225.3 6.5e-61
CAA54487 Bet v 1.0106 160 990 224.4 1.2e-60
CAB02161 Bet v 1.0114 160 990 224.4 1.2e-60
CAB02160 Bet v 1.0113 160 989 224.2 1.4e-60
CAA07323.1 Bet v 1.0117 160 988 223.9 1.6e-60
CAB02155 Bet v 1.0108 160 987 223.7 1.9e-60
CAA54484 Bet v 1.0104 160 984 223.1 2.9e-60
CAB02157 Bet v 1.0110 160 982 222.6 4e-60
CAA04827.1 Bet v 1.0116 159 980 222.2 5.4e-60
CAA54483 Bet v 1.0103 160 973 220.7 1.6e-59
CAB02158 Bet v 1.0111 160 972 220.4 1.8e-59
CAA54482 Bet v 1.0102 160 968 219.6 3.3e-59
CAA54485 Bet v 1.0105 160 966 219.1 4.5e-59
CAA54489 Bet v 1.0107 160 960 217.8 1.1e-58
CAA07329.1 Bet v 1.0118 160 951 215.8 4.4e-58
P43186 Bet v 1.0204 160 916 208.2 9e-56
ABC41615.1 Bet v 1.0119 150 912 207.3 1.5e-55
CAA04828.1 Bet v 1.0206 159 911 207.1 1.9e-55
Q39427 Bet v 1.0205 160 908 206.4 3e-55
CAA54421 Bet v 1.0201 160 906 206.0 4.1e-55
P43184 Bet v 1.0203 160 903 205.3 6.5e-55
CAA54481 Bet v 1.0202 160 894 203.4 2.5e-54
CAA96548 Cor a 1.0201 160 866 197.2 1.8e-52
AAB24432 Aln g 1 160 850 193.7 2e-51
P38948 Aln g 1 159 843 192.2 5.8e-51
ACF75030.1 Bet v 1.0207 150 842 192.0 6.2e-51
CAB02217 Car b 1.0302 161 821 187.4 1.7e-49
CAB02216 Car b 1.0301 161 796 181.9 7.4e-48
CAB02207 Car b 1.0104 160 785 179.5 3.9e-47
CAB02206 Car b 1.0103 160 784 179.3 4.6e-47
ABZ81044 Car b 1.0113 160 781 178.6 7.2e-47
ABZ81040 Car b 1.0109 160 778 177.9 1.1e-46
ABZ81043 Car b 1.0112 160 774 177.1 2.1e-46
ABZ81042 Car b 1.0111 160 774 177.1 2.1e-46
ADK39021 Ost c 1.0101 160 773 176.8 2.4e-46
ABZ81041 Car b 1.0110 160 773 176.8 2.4e-46
P38950 Car b 1 159 772 176.6 2.8e-46
CAB02208 Car b 1.0105 160 772 176.6 2.8e-46
CAA50325 Cor a 1.0103 160 769 176.0 4.5e-46
CAA50328 Cor a 1.0102 160 767 175.5 6e-46
CAB02209 Car b 1.0106 160 762 174.4 1.3e-45
CAB02213 Car b 1.0107 160 760 174.0 1.7e-45
CAA50327 Cor a 1.0101 160 760 174.0 1.7e-45
CAA54696.1 Bet v 1.0301 160 760 174.0 1.7e-45
CAA47357 Car b 1.0102 159 756 173.1 3.2e-45
P38949 Car b 1 159 754 172.7 4.3e-45
Q08407 Cor a 1 159 753 172.5 5e-45
CAB02215 Car b 1.0108 160 750 171.8 8e-45
CAA50326 Cor a 1.0104 160 741 169.8 3.1e-44
CAA96549 Cor a 1.0301 160 727 166.8 2.6e-43
AAD48405 Cor a 1.0401 161 700 160.8 1.6e-41
AAG40331 Cor a 1.0404 161 697 160.2 2.5e-41
AAG40329 Cor a 1.0402 161 694 159.5 4e-41
CAD10374 Cas s 1 160 693 159.3 4.6e-41
AAG40330 Cor a 1.0403 161 691 158.9 6.3e-41
CAA96535 Mal d 1.0401 160 680 156.5 3.3e-40
APD76154 Jug r 5.0101 160 676 155.6 6e-40
ACJ23864 Fag s 1.0101 160 676 155.6 6e-40
CAA96536 Mal d 1.0402 160 667 153.6 2.4e-39
CAA96537 Mal d 1.0403 160 663 152.7 4.4e-39
O24248 Pru av 1 160 634 146.4 3.6e-37
CAA96534 Mal d 1.0301 159 632 146.0 4.8e-37
Q2I6V8 Pru p 1.0101 160 630 145.5 6.5e-37
O50001 Pru ar 1 160 622 143.8 2.2e-36
AAO25113 Mal d 1.0304 159 618 142.9 4e-36
ABZ81046 Que a 1.0301 160 618 142.9 4e-36
AAK13027 Mal d 1.0302 159 615 142.2 6.3e-36
AUH28179 Que m 1.0101 160 602 139.4 4.6e-35
AAK13028 Mal d 1.0303 159 599 138.7 7.2e-35
QOL10866 Que ac 1.0101 159 594 137.6 1.5e-34
AAD26546 Mal d 1.0103 159 592 137.2 2.1e-34
QGS84240 Que i 1.0101 159 591 137.0 2.4e-34
AAB01362 Mal d 1.0201 159 590 136.8 2.8e-34
AAD26545 Mal d 1.0202 159 590 136.8 2.8e-34
AAD29671 Mal d 1.0108 159 590 136.8 2.8e-34
O65200 Pyr c 1 159 589 136.5 3.3e-34
AAD26552 Mal d 1.0104 159 588 136.3 3.8e-34
CAA88833 Mal d 1.0102 159 588 136.3 3.8e-34
B6CQS9 Pru du 1.0101 160 588 136.3 3.8e-34
AAD26548 Mal d 1.0204 159 586 135.9 5.2e-34
CAA58646 Mal d 1.0101 159 585 135.7 6e-34
AAD26555 Mal d 1.0107 159 585 135.7 6e-34
AAD13683 Mal d 1.0206 159 585 135.7 6e-34
AAK13030 Mal d 1.0207 159 584 135.4 7e-34
AAD26547 Mal d 1.0203 159 584 135.4 7e-34
AAD26554 Mal d 1.0106 159 584 135.4 7e-34
AAD26553 Mal d 1.0105 159 584 135.4 7e-34
AAD26558 Mal d 1.0205 159 582 135.0 9.5e-34
Q256S7 Fra a 1 160 582 135.0 9.6e-34
Q3T923 Fra a 1 160 580 134.6 1.3e-33
AAK13029 Mal d 1.0109 159 579 134.3 1.5e-33
AFN42528 Can s 5.0101 161 579 134.3 1.5e-33
ABZ81045 Que a 1.0201 159 578 134.1 1.7e-33
CAD32318 Mal d 1.0208 158 577 133.9 2e-33
ABZ81047 Que a 1.0401 160 577 133.9 2e-33
Q256S6 Fra a 1 160 573 133.0 3.8e-33
Q256S4 Fra a 1 159 572 132.8 4.3e-33
Q256S2 Fra a 1 160 571 132.6 5.1e-33
CAM31908 Act c 8.0101 159 492 115.3 8.2e-28
CAM31909 Act d 8.0101 157 485 113.8 2.3e-27
Q0Z8U9 Rub i 1.0101 137 481 113.0 3.5e-27
CAA42646 Gly m 4 158 473 111.1 1.4e-26
CAA43637 Pha v 1 156 455 107.2 2.2e-25
AHC08073 Sola l 4.0101 160 450 106.1 4.9e-25
CAA43636 Pha v 1 155 448 105.7 6.3e-25
P25985 Pha v 1 155 448 105.7 6.3e-25
AAQ91847 Ara h 8.0101 157 444 104.8 1.2e-24
NP_001275580 Sola l 4.0201 160 443 104.5 1.4e-24
Q2VU97 Vig r 1.0101 155 413 98.0 1.3e-22
P49372 Api g 1 154 406 96.5 3.7e-22
CAA75803 Lyc e 4.0101 178 404 95.9 6.2e-22
EF436550 Ara h 8.0201 153 402 95.6 6.6e-22
CAA67246 Pet c PR10 155 387 92.3 6.6e-21
P92918 Api g 1.0201 159 372 89.0 6.7e-20
AAB92255 Tar o RAP 157 370 88.6 8.9e-20
CAB03716 Dau c 1.0104 154 368 88.1 1.2e-19
CAB06416 Dau c 1.0105 154 365 87.5 1.8e-19
AAL76932 Dau c 1.0201 154 364 87.3 2.2e-19
BAA13604 Dau c 1.0102 154 364 87.3 2.2e-19
AAB01092 Dau c 1.0101 168 362 86.8 3.3e-19
CAB03715 Dau c 1.0103 154 355 85.3 8.4e-19
Q5ULZ4 Fra a 1.0101 100 248 62.2 5e-12
P85126 Que a 1.0101 50 215 55.5 2.6e-10
Q9ZWP8 Vig r 6.0101 155 197 50.7 2.2e-08
Q9S8Q4 Cas s 1 24 114 33.9 0.0004
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 233.1 bits 1030,  Expect = 3e-63
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 226.8 bits 1001,  Expect = 2e-61
 Identities = 155/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIKIVATPDG SILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 226.6 bits 1000,  Expect = 3e-61
 Identities = 154/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG SILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 225.3 bits 994,  Expect = 6e-61
 Identities = 154/160 96%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG+PFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIKIVATPDG SILKISNK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 224.4 bits 990,  Expect = 1e-60
 Identities = 153/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKYSYSVIEGGP+GDTLEKISNEIKIVATP+G SILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 224.4 bits 990,  Expect = 1e-60
 Identities = 154/160 96%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIKIVATPDG SILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEM ETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 224.2 bits 989,  Expect = 1e-60
 Identities = 153/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG SILKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 223.9 bits 988,  Expect = 2e-60
 Identities = 152/160 95%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 223.7 bits 987,  Expect = 2e-60
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 223.1 bits 984,  Expect = 3e-60
 Identities = 152/160 95%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKYSYSVIEGGP+GDTLEKISNEIKIVATP+G SILKI+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 222.6 bits 982,  Expect = 4e-60
 Identities = 151/160 94%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGD LEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 222.2 bits 980,  Expect = 5e-60
 Identities = 151/159 94%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G PFKYVKDRVDEV H NFKYSYS+IEGGP+GDTLEKISNEIKIVATPDG SILKISNKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 13. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 220.7 bits 973,  Expect = 2e-59
 Identities = 151/160 94%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK RVDEV H NFKYSYSVIEGGP+GDTLEKISNEIKIVATP+G SILKI+NK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 220.4 bits 972,  Expect = 2e-59
 Identities = 150/160 93%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
             G+PFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 219.6 bits 968,  Expect = 3e-59
 Identities = 148/160 92%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 219.1 bits 966,  Expect = 5e-59
 Identities = 147/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 217.8 bits 960,  Expect = 1e-58
 Identities = 146/160 91%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAAR+FKAFILDGD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  +LKISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+HEVKAEQ+KASKEMGETLLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 215.8 bits 951,  Expect = 4e-58
 Identities = 147/160 91%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIK+VATPDG SIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 208.2 bits 916,  Expect = 9e-56
 Identities = 142/160 88%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 207.3 bits 912,  Expect = 1e-55
 Identities = 140/150 93%, Positives = 146/150 97%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSV+NIEGNGGPGTIKKI+FPEGF
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHT 123
            PFKYVKDRVDEV H NFKY+YSVIEGGP+GDTLEKISNEIKIVATPDG  ILKISNKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEVKAEQIKASKEMGETLLRAVESYLL 153
            KG+HEVKAEQ+KASKEMGETLLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 21. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 207.1 bits 911,  Expect = 2e-55
 Identities = 141/159 88%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE+ETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIK+VATPDG SILKISNKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHE+KAE++KA KE GETLLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 22. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 206.4 bits 908,  Expect = 3e-55
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIK+VATPDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 206.0 bits 906,  Expect = 4e-55
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 205.3 bits 903,  Expect = 6e-55
 Identities = 140/160 87%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 203.4 bits 894,  Expect = 3e-54
 Identities = 139/160 86%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD L PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD+E+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 26. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 197.2 bits 866,  Expect = 2e-52
 Identities = 132/160 82%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE+TSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RV+EV H NFKYSY+VIEGGP+GD +EKI NEIKIVA PDG SILKISNK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 193.7 bits 850,  Expect = 2e-51
 Identities = 130/160 81%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFKYVK+RVDEV   NFKYS+SVIEGG +GD LEK+ NEIKIVA PDG SILKISNK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +HTKGDHE+ AEQIK  KE    LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 192.2 bits 843,  Expect = 6e-51
 Identities = 129/159 81%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G PFKYVK+RVDEV   NFKYS+SVIEGG +GD LEK+ NEIKIVA PDG SILKISNK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGDHE+ AEQIK  KE    LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 29. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 192.0 bits 842,  Expect = 6e-51
 Identities = 131/150 87%, Positives = 140/150 93%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYE+ETTSVIPAARLFKAFIL+GDNL PKVAPQAISSVENIEGNGGPGTIKKI+FPEG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHT 123
            PFKYVK+RVDEV H NFKYSYS+IEGG +GDTLEKI NEIKIVATPDG SILKISNKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEVKAEQIKASKEMGETLLRAVESYLL 153
            KGDHE+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 187.4 bits 821,  Expect = 2e-49
 Identities = 125/160 78%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+NL PKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P KYVK+RV+EV H NFKYSY+VIEGGP+GD +EKI NEIKIVA PDG SILKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 181.9 bits 796,  Expect = 7e-48
 Identities = 122/160 76%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P KYVK+RV+EV H NFKYSY+VIEGG +GD +EKI NEIKIVA PDG SILKI++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHEV AE+IK  KE  E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 32. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 179.5 bits 785,  Expect = 4e-47
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 33. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 179.3 bits 784,  Expect = 5e-47
 Identities = 117/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 34. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 178.6 bits 781,  Expect = 7e-47
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKYSY+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 177.9 bits 778,  Expect = 1e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SILKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 36. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 177.1 bits 774,  Expect = 2e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 37. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 177.1 bits 774,  Expect = 2e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 38. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 176.8 bits 773,  Expect = 2e-46
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SILKIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 176.8 bits 773,  Expect = 2e-46
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G S++KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 40. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 176.6 bits 772,  Expect = 3e-46
 Identities = 116/159 72%, Positives = 137/159 86%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ETTSVIPAARLFKAFILDG+ L PKV+PQA+SSVEN+EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G P KYVK+RV+E+ H NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 41. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 176.6 bits 772,  Expect = 3e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 176.0 bits 769,  Expect = 4e-46
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE+IK +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 175.5 bits 767,  Expect = 6e-46
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +KYVK+RVDEV + NFKYSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 174.4 bits 762,  Expect = 1e-45
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 45. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 174.0 bits 760,  Expect = 2e-45
 Identities = 116/160 72%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFK+SY+VIEG  +GD LEK+S E+KIVA P G SILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 174.0 bits 760,  Expect = 2e-45
 Identities = 114/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 47. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 174.0 bits 760,  Expect = 2e-45
 Identities = 115/160 71%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVI  ARLFK+F+LD DNL PKVAP+ +SS ENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  FKY+K RVDE+ H NFKY YS+IEGGP+GDTLEKIS EIKIVA P G SILKI++K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD  +  E+IKA KE G  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 48. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 173.1 bits 756,  Expect = 3e-45
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 49. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 172.7 bits 754,  Expect = 4e-45
 Identities = 113/159 71%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQ ISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G PFK+VK+RVDEV + NFKY+Y+VIEG  +GD LEK+S+E+KIVA P G SI+KIS+K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KG HEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 50. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 172.5 bits 753,  Expect = 5e-45
 Identities = 113/159 71%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 51. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 171.8 bits 750,  Expect = 8e-45
 Identities = 114/160 71%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SV+PAARLFK+++LD D L PKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PFK+VK+RVDEV + NFK+SY+VIEG  +GD LEK+S E+ IVA P G SILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHEV AE++K +KEM E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 169.8 bits 741,  Expect = 3e-44
 Identities = 112/160 70%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVI AARLFK+++LDGD L PKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +KYVK+RVDEV + NFKYSY+VIEG  +GD LEK+ +E+KIVA P G S LKIS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 166.8 bits 727,  Expect = 3e-43
 Identities = 113/160 70%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIP ARLFK F+LD DNL PKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG PF Y+K +V+E+ + NF Y YSVIEG  + D LEKI+ EIKIVA+P G SILK  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHT GDHE+K EQIKA KE    L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 160.8 bits 700,  Expect = 2e-41
 Identities = 107/159 67%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGR-SILKISN 119
            EG  FKY+K +V+E+ H NFKY YS+IEGGP+G TLEKIS EIK+ A P G  SILKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 160.2 bits 697,  Expect = 3e-41
 Identities = 106/159 66%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGR-SILKISN 119
            EG  FKY+K +V+E+ H NFKY YS+IEGGP+G TLEKI  EIK+ A P G  SILKI++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 159.5 bits 694,  Expect = 4e-41
 Identities = 105/159 66%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGR-SILKISN 119
            EG  FKY+K +V+E+ H NFKY YS+IEGGP+G TLEKIS EIK+ A P G  SILKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 159.3 bits 693,  Expect = 5e-41
 Identities = 106/160 66%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS IP  RLFKAF+LD DNL PK+AP+AI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  FKYVK R+DE+ + NF Y YSVIEG  + + LEKIS EIKIVA+PDG SILK ++K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG++E+K E++ A KE    L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 158.9 bits 691,  Expect = 6e-41
 Identities = 105/159 66%, Positives = 125/159 78%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNL PKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGR-SILKISN 119
            EG  FKY+K +V+E+ H NFKY YS+IEGGP+G TLEKIS EIK+ A P G  SILKI++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            KYHTKG+  +  E+IKA KE    L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 156.5 bits 680,  Expect = 3e-40
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK RV+ +   NF YSYS+IEG  + D LEKI+ E K++A+PDG SI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 155.6 bits 676,  Expect = 6e-40
 Identities = 104/160 65%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE+TSVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +KYVK R D +   NF Y+YSVIEG  + D +EKIS E KIVA+ +G SILK  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH+KGDHE+K E +K  KE    L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 61. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 155.6 bits 676,  Expect = 6e-40
 Identities = 104/160 65%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNL PKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  F YVK R+DE+ + NF Y+ ++IEG  I +TLEKI+ EIK+VA+PDG SILK ++K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGDHE+K +QIKA KE    +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 153.6 bits 667,  Expect = 2e-39
 Identities = 101/160 63%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S + IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK RV+ +   NF YSYS+IEG  + D LEKI+ E K++A+PDG SI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 152.7 bits 663,  Expect = 4e-39
 Identities = 101/160 63%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK RV+ +   NF YSYS+IEG  + D LEKI+ E K++A+PDG SI+K ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y  KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 146.4 bits 634,  Expect = 4e-37
 Identities = 93/160 58%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D +  +N+ YSY++IEG  +GDTLEKIS E K+VA+P G SI+K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 146.0 bits 632,  Expect = 5e-37
 Identities = 98/159 61%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D V  +NF Y YSVIEG  I +T+EKIS E K+VA+  G S++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTK D E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 66. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 145.5 bits 630,  Expect = 7e-37
 Identities = 93/160 58%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D +  +N  YSY++IEG  +GD LEKIS E K+VA+P G SI+K ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 143.8 bits 622,  Expect = 2e-36
 Identities = 94/160 58%, Positives = 120/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE TSVIP  +LFKAFILD DNL PKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK RVD +   N+ YSY++IEG  + D +E I+ +IK+VA+PDG SI+K ++ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K EQ+KA KE    L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 68. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 142.9 bits 618,  Expect = 4e-36
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D V  +NF Y YSVIEG  I +T+EKIS E K+VA+  G S++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 69. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 142.9 bits 618,  Expect = 4e-36
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +K+ K R+D +  +NF YS+SVIEG  + D LE +S E KIVA+PDG SI+K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 142.2 bits 615,  Expect = 6e-36
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D V   NF Y YSVIEG  I +T+EKIS E K+VA   G S++K ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSG-SVIKSTSH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 71. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 139.4 bits 602,  Expect = 5e-35
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  YE+E  SVIP ARLFKAF+LD DNL PKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +K+ K R+D +  +NF +S+SVIEG  + D LE +S E KIVA+PDG SI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 72. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 138.7 bits 599,  Expect = 7e-35
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARL+ AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   NF Y YSVIEG  I +T+EKIS E K+VA+  G S++K  + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSG-SVIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 73. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 137.6 bits 594,  Expect = 2e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNL  KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    KY K R+D +  +N  YS+SVIEG  + D +  IS E+K VA+PDG SI+K + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y+TKG  ++K EQI+A+ E G  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 74. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 137.2 bits 592,  Expect = 2e-34
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 137.0 bits 591,  Expect = 2e-34
 Identities = 95/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E   FKY K R+D +  +N  YS+SVIEG  + D +  +S EIK VA+PDG SI K + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 76. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 136.8 bits 590,  Expect = 3e-34
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 136.8 bits 590,  Expect = 3e-34
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 136.8 bits 590,  Expect = 3e-34
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 79. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 136.5 bits 589,  Expect = 3e-34
 Identities = 90/159 56%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG++ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK RVD +   ++ Y+Y++IEG  + DT+EKIS E K+VA+  G +I  IS+ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 136.3 bits 588,  Expect = 4e-34
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 136.3 bits 588,  Expect = 4e-34
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YH KG+ E+K E++K  KE G  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 136.3 bits 588,  Expect = 4e-34
 Identities = 86/160 53%, Positives = 119/160 74%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG+F Y  E+TSVIP  RLFKA++L+ D L PK+APQ++ S E +EG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D +   NF Y+YS++EG  + D +EKIS EIK+VA+ DG S++K ++ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E +KA KE    L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 83. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 135.9 bits 586,  Expect = 5e-34
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K++A+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 135.7 bits 585,  Expect = 6e-34
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++K  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 135.7 bits 585,  Expect = 6e-34
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA K     L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 135.7 bits 585,  Expect = 6e-34
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFK F+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 135.4 bits 584,  Expect = 7e-34
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 135.4 bits 584,  Expect = 7e-34
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 135.4 bits 584,  Expect = 7e-34
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+E IS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 135.4 bits 584,  Expect = 7e-34
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 135.0 bits 582,  Expect = 9e-34
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISH 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++ A KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 92. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 135.0 bits 582,  Expect = 1e-33
 Identities = 86/160 53%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 93. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 134.6 bits 580,  Expect = 1e-33
 Identities = 84/160 52%, Positives = 113/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +++K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 94. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 134.3 bits 579,  Expect = 1e-33
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKG+ E+K E++K  KE    L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 134.3 bits 579,  Expect = 2e-33
 Identities = 85/160 53%, Positives = 121/160 75%, Gaps = 1/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS I  ARLFKAF+LDGDNL PK+APQA+  VE +EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPI-GDTLEKISNEIKIVATPDGRSILKISN 119
            +G PFKYVK +++ +  +++ YSYS+IEG  + G+ LEKI++E K+VA+ DG +++K  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            KY++ GD +V  E++K  ++    +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 96. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 134.1 bits 578,  Expect = 2e-33
 Identities = 93/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E   FKY K R+D +  +N  YS+SVIEG  +   +E +S EIK VA+PDG SI+K + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++K EQI+A+ E    LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 97. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 133.9 bits 577,  Expect = 2e-33
 Identities = 88/158 55%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GV+ YE E TS IP  RLFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
            G  + YVK ++D V   N+ Y+Y++IEG  + DT+EK+S E K+VA+  G SI+K  + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSG-SIIKSISHY 119
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            HTKGD E+  E++KA KE    L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 98. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 133.9 bits 577,  Expect = 2e-33
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  +K+ K R+D +  +NF YS+SVIEG  + D LE +S E KIVA+PDG SI K ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            Y+TKGD ++  E I+  KE    +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 99. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 133.0 bits 573,  Expect = 4e-33
 Identities = 85/160 53%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG + YE E TS IPA +LFKAF+LD DNL PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 100. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 132.8 bits 572,  Expect = 4e-33
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++  +  +N  YSYS+IEG  + D +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 101. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 132.6 bits 571,  Expect = 5e-33
 Identities = 84/160 52%, Positives = 112/160 70%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNL PK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG  + YVK ++  +   N  YSYS+IEG  + + +EKI  E K+V+ P G +I+K ++K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KE    L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 102. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 115.3 bits 492,  Expect = 8e-28
 Identities = 79/157 50%, Positives = 106/157 67%, Gaps = 0/157 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG   K VK RVD +   N+ YSY++IEG  + + +E IS  IKIVA PDG SI K  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 113.8 bits 485,  Expect = 2e-27
 Identities = 79/156 50%, Positives = 104/156 66%, Gaps = 1/156 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG   Y+ E  S I A ++FKAF+LDGD + PK  P+AI+ V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG   K VK R+D +  +NF YSYS+IEGG + D +E IS  IKIVATPDG  I K  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157
            Y  K D +V  E+IKA KE    +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 113.0 bits 481,  Expect = 3e-27
 Identities = 75/135 55%, Positives = 97/135 71%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKD 70
            TSVIP  +LFKAF+LD DNL PK+APQA+ SVE IEG+GG GT+KKI + EG    YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHTKGDHEVK 130
            ++D +   NF YSYS+ EG  +GD +EKIS EIK+VA+  G SI+K ++ YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIK 120
Query  131  AEQIKASKEMGETLLR 146
             EQ+K  KE    L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 111.1 bits 473,  Expect = 1e-26
 Identities = 76/158 48%, Positives = 107/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E  S +  A L+KA++ D DN+ PK A  +  SVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    K+V  +++ +   N+ YSYSV+ G  + DT EKI+ + K+VA P+G S  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160
            Y TKGD E   +++K  K   + L++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 106. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 107.2 bits 455,  Expect = 2e-25
 Identities = 70/155 45%, Positives = 104/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    K+V  +++ +   N+ YSYS++ G  + +T EKI+ + K+   P+G S++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 106.1 bits 450,  Expect = 5e-25
 Identities = 70/159 44%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P KY+K ++  +  KN++  YS+IEG  +G+ LE I+ +IK  A  +G  + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGDH V  E+    +E    + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 105.7 bits 448,  Expect = 6e-25
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF +E +TTS +  A L+KA++ D D + PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    K+V  +++E+   N+ YSYS++ G  + DT EKIS + K+   P+G S++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH+KGD     +++KA K   + L++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 105.7 bits 448,  Expect = 6e-25
 Identities = 69/154 44%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
                K+V  +++ +   N+ YSYS++ G  + +T EKI+ + K+   P+G S++K+S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 104.8 bits 444,  Expect = 1e-24
 Identities = 71/157 45%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    K++  +V+ +   N+ Y+YSV+ G  +  T EKI+ E K+V  P+G SI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 111. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 104.5 bits 443,  Expect = 1e-24
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P KY+K ++  +  KN+   YS+IEG  +GD LE I+ ++K  A  DG  + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 98.0 bits 413,  Expect = 1e-22
 Identities = 68/154 44%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF ++ + TS +  A L+ A+  D DN+ PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E    K+V  +++ V   N+ YSYS++ G  + DT EKI+ + KI    DG S++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            YH KGD     +++KA K   + L++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 113. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 96.5 bits 406,  Expect = 4e-22
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            +G P   +  R+D V  + + + YSVI+G  +   +E I N + +V T DG SI K +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 95.9 bits 404,  Expect = 6e-22
 Identities = 62/150 41%, Positives = 93/150 62%, Gaps = 0/150 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P KY+K ++  +  KN++  YS+IEG  +G+ LE I+ +IK  A  +G  + K + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVES 150
            YHTKGDH V  E+    +      ++   S
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQGCRS 150

Sequence Alignment: 115. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 95.6 bits 402,  Expect = 7e-22
 Identities = 63/153 41%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E+TS +P A+LFKA ++DGD L PK+ P AI S+E +EGNGGPGT+KK++  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E     YV  ++D +    + Y Y++  G    + LEK+S + K+ A  DG S +K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  +  E  +  K+  + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 92.3 bits 387,  Expect = 7e-21
 Identities = 61/155 39%, Positives = 97/155 62%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            +  P+K +K ++D +  + F +SYS+I+G  +   ++ I+N +  V T DG      +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            ++TKGD  V  E IK + +    +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 89.0 bits 372,  Expect = 7e-20
 Identities = 61/154 39%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV     E  S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E   +  +K +VD +    + Y+Y+ I G  + D LE + NE  +V T DG  I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            Y+TKGD  +  ++IK + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 88.6 bits 370,  Expect = 9e-20
 Identities = 54/152 35%, Positives = 92/152 60%, Gaps = 0/152 0%
Query  7    ETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFK 66
            E E TS +  + +FKAF++D D + PK  P+   S++ IEG+GG GTIK I++ +G PF 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHTKGD 126
              K +VD +   NF  SY++ EG  +   +E  ++ +K + + DG S+ K S  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEVKAEQIKASKEMGETLLRAVESYLLAHSDA 158
             ++  E +   KE  +  ++A+E+Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 88.1 bits 368,  Expect = 1e-19
 Identities = 59/154 38%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P   +  R D V  + + Y  +VI+G  +   +E I   + +V T DG SI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK + E    L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 87.5 bits 365,  Expect = 2e-19
 Identities = 59/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P   +  R D V  + + Y  +VI+G  +   +E I   + +V T DG SI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 87.3 bits 364,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E E  S + A ++++ F+LD D +FPKV PQ I SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E   +  +K +VD +    + Y+Y+ I G  + + LE + N+  +V T DG  I+K +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            Y+TKGD  +  +++K + E     ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 87.3 bits 364,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P   +  R D V  + + Y  +VI+G  + + +E I   + +V T DG SI K +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 86.8 bits 362,  Expect = 3e-19
 Identities = 58/154 37%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK AP A  SV+ ++G+GG GT++ I++P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P   +  R D V  + + Y  +VI+G  + + +E I   + +V T DG SI K +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 85.3 bits 355,  Expect = 8e-19
 Identities = 58/154 37%, Positives = 90/154 58%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D + PK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            EG P   +  R D V  + + Y  +VI+G  +   +E I   + +V T DG SI K +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155
            +HTKGD  V  E IK +      L++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.2 bits 248,  Expect = 5e-12
 Identities = 52/100 52%, Positives = 69/100 69%, Gaps = 39/100 39%
Query  22   AFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVAHKNFK 81
            AF+LD DNL PK                      KI+F EG  + YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKASKEMG 141
                 +EG  + DTLEKI  E K+V+ P   +I+K ++KYHTKGD E+K E++KA KE  
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  ETLLRAVESYLLAHSDAYN 160
              L++ +E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 55.5 bits 215,  Expect = 3e-10
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 50.7 bits 197,  Expect = 2e-08
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
            E  P  Y ++ + E    + +    VIEGG +   L       K+    + ++++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152
            Y    D E K    K S+      LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.9 bits 114,  Expect = 0.0004
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYETETTSVIPAARLFKAFIL 25
            GVF +E++ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.