The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP
EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK
YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA07329.1 Bet v 1.0118 160 1038 228.6 6.6e-62
CAB02160 Bet v 1.0113 160 984 217.1 1.8e-58
CAA33887 Bet v 1.0101 160 983 216.9 2.1e-58
CAB02156 Bet v 1.0109 160 982 216.7 2.5e-58
CAB02159 Bet v 1.0112 160 976 215.4 5.9e-58
P43186 Bet v 1.0204 160 972 214.6 1.1e-57
CAB02161 Bet v 1.0114 160 972 214.6 1.1e-57
CAA07323.1 Bet v 1.0117 160 970 214.1 1.4e-57
Q39427 Bet v 1.0205 160 970 214.1 1.4e-57
CAB02155 Bet v 1.0108 160 969 213.9 1.7e-57
CAB02157 Bet v 1.0110 160 964 212.9 3.5e-57
CAA04828.1 Bet v 1.0206 159 963 212.7 4e-57
CAA54482 Bet v 1.0102 160 963 212.7 4e-57
CAA54421 Bet v 1.0201 160 962 212.4 4.7e-57
CAA54487 Bet v 1.0106 160 962 212.4 4.7e-57
CAA54485 Bet v 1.0105 160 961 212.2 5.4e-57
P43184 Bet v 1.0203 160 959 211.8 7.2e-57
CAA54484 Bet v 1.0104 160 956 211.2 1.1e-56
CAA54489 Bet v 1.0107 160 955 211.0 1.3e-56
CAB02158 Bet v 1.0111 160 954 210.7 1.5e-56
CAA96547 Bet v 1.0115 160 951 210.1 2.3e-56
CAA54481 Bet v 1.0202 160 950 209.9 2.7e-56
CAA04827.1 Bet v 1.0116 159 947 209.3 4.2e-56
CAA54483 Bet v 1.0103 160 945 208.8 5.7e-56
ACF75030.1 Bet v 1.0207 150 898 198.9 5.2e-53
ABC41615.1 Bet v 1.0119 150 894 198.1 9.3e-53
CAA96548 Cor a 1.0201 160 894 198.0 1e-52
AAB24432 Aln g 1 160 859 190.6 1.7e-50
P38948 Aln g 1 159 852 189.1 4.8e-50
CAB02217 Car b 1.0302 161 846 187.9 1.2e-49
CAB02216 Car b 1.0301 161 821 182.6 4.7e-48
CAB02207 Car b 1.0104 160 798 177.7 1.4e-46
CAB02206 Car b 1.0103 160 797 177.5 1.6e-46
ABZ81040 Car b 1.0109 160 791 176.2 3.8e-46
P38950 Car b 1 159 790 176.0 4.4e-46
ABZ81042 Car b 1.0111 160 787 175.3 6.8e-46
ABZ81043 Car b 1.0112 160 787 175.3 6.8e-46
ABZ81041 Car b 1.0110 160 786 175.1 7.9e-46
ADK39021 Ost c 1.0101 160 786 175.1 7.9e-46
CAB02208 Car b 1.0105 160 785 174.9 9.2e-46
ABZ81044 Car b 1.0113 160 784 174.7 1.1e-45
CAA54696.1 Bet v 1.0301 160 781 174.1 1.6e-45
CAA50328 Cor a 1.0102 160 777 173.2 3e-45
CAB02209 Car b 1.0106 160 775 172.8 4e-45
CAA50325 Cor a 1.0103 160 771 172.0 7.2e-45
CAA50327 Cor a 1.0101 160 770 171.7 8.3e-45
CAA47357 Car b 1.0102 159 769 171.5 9.5e-45
P38949 Car b 1 159 767 171.1 1.3e-44
Q08407 Cor a 1 159 763 170.3 2.3e-44
CAB02213 Car b 1.0107 160 763 170.3 2.3e-44
CAB02215 Car b 1.0108 160 753 168.1 1e-43
CAA50326 Cor a 1.0104 160 751 167.7 1.4e-43
CAA96549 Cor a 1.0301 160 745 166.4 3.3e-43
AAD48405 Cor a 1.0401 161 721 161.4 1.1e-41
AAG40331 Cor a 1.0404 161 718 160.7 1.7e-41
AAG40329 Cor a 1.0402 161 715 160.1 2.7e-41
AAG40330 Cor a 1.0403 161 712 159.4 4.2e-41
CAA96535 Mal d 1.0401 160 710 159.0 5.6e-41
CAD10374 Cas s 1 160 710 159.0 5.6e-41
CAA96536 Mal d 1.0402 160 697 156.3 3.8e-40
CAA96537 Mal d 1.0403 160 693 155.4 6.8e-40
APD76154 Jug r 5.0101 160 693 155.4 6.8e-40
ACJ23864 Fag s 1.0101 160 689 154.6 1.2e-39
O24248 Pru av 1 160 659 148.2 1e-37
Q2I6V8 Pru p 1.0101 160 655 147.4 1.8e-37
CAA96534 Mal d 1.0301 159 652 146.7 2.8e-37
AAO25113 Mal d 1.0304 159 638 143.8 2.2e-36
AAK13027 Mal d 1.0302 159 637 143.6 2.5e-36
O50001 Pru ar 1 160 637 143.6 2.5e-36
ABZ81046 Que a 1.0301 160 632 142.5 5.3e-36
AAK13028 Mal d 1.0303 159 623 140.6 2e-35
AUH28179 Que m 1.0101 160 618 139.5 4.2e-35
B6CQS9 Pru du 1.0101 160 618 139.5 4.2e-35
AAD26546 Mal d 1.0103 159 617 139.3 4.8e-35
O65200 Pyr c 1 159 616 139.1 5.5e-35
AAD29671 Mal d 1.0108 159 615 138.9 6.4e-35
CAA88833 Mal d 1.0102 159 614 138.7 7.4e-35
AAD26545 Mal d 1.0202 159 613 138.5 8.6e-35
AAB01362 Mal d 1.0201 159 613 138.5 8.6e-35
AAD26552 Mal d 1.0104 159 613 138.5 8.6e-35
QOL10866 Que ac 1.0101 159 611 138.0 1.2e-34
AAD26555 Mal d 1.0107 159 610 137.8 1.3e-34
CAA58646 Mal d 1.0101 159 610 137.8 1.3e-34
AAD26553 Mal d 1.0105 159 609 137.6 1.5e-34
AAD26554 Mal d 1.0106 159 609 137.6 1.5e-34
AAD26548 Mal d 1.0204 159 609 137.6 1.5e-34
AAD13683 Mal d 1.0206 159 608 137.4 1.8e-34
Q256S7 Fra a 1 160 608 137.4 1.8e-34
QGS84240 Que i 1.0101 159 607 137.2 2.1e-34
AAD26547 Mal d 1.0203 159 607 137.2 2.1e-34
AAK13030 Mal d 1.0207 159 607 137.2 2.1e-34
Q3T923 Fra a 1 160 606 137.0 2.4e-34
AAD26558 Mal d 1.0205 159 605 136.8 2.8e-34
AAK13029 Mal d 1.0109 159 604 136.6 3.2e-34
Q256S2 Fra a 1 160 602 136.1 4.4e-34
CAD32318 Mal d 1.0208 158 600 135.7 5.8e-34
Q256S6 Fra a 1 160 599 135.5 6.8e-34
ABZ81045 Que a 1.0201 159 594 134.4 1.4e-33
ABZ81047 Que a 1.0401 160 593 134.2 1.6e-33
Q256S4 Fra a 1 159 587 133.0 3.9e-33
AFN42528 Can s 5.0101 161 586 132.7 4.6e-33
CAA42646 Gly m 4 158 502 114.9 1e-27
CAM31908 Act c 8.0101 159 501 114.7 1.2e-27
CAM31909 Act d 8.0101 157 491 112.6 5.1e-27
Q0Z8U9 Rub i 1.0101 137 485 111.4 1e-26
CAA43636 Pha v 1 155 477 109.7 4e-26
AAQ91847 Ara h 8.0101 157 476 109.4 4.7e-26
CAA43637 Pha v 1 156 465 107.1 2.3e-25
AHC08073 Sola l 4.0101 160 462 106.5 3.7e-25
P25985 Pha v 1 155 458 105.6 6.4e-25
NP_001275580 Sola l 4.0201 160 458 105.6 6.7e-25
EF436550 Ara h 8.0201 153 445 102.9 4.3e-24
Q2VU97 Vig r 1.0101 155 436 101.0 1.6e-23
P49372 Api g 1 154 418 97.2 2.3e-22
CAA75803 Lyc e 4.0101 178 415 96.4 4.3e-22
CAA67246 Pet c PR10 155 397 92.7 5e-21
AAB92255 Tar o RAP 157 390 91.2 1.4e-20
CAB03716 Dau c 1.0104 154 378 88.7 8.1e-20
P92918 Api g 1.0201 159 378 88.7 8.5e-20
CAB06416 Dau c 1.0105 154 375 88.0 1.3e-19
BAA13604 Dau c 1.0102 154 374 87.8 1.5e-19
AAB01092 Dau c 1.0101 168 372 87.4 2.2e-19
AAL76932 Dau c 1.0201 154 370 87.0 2.6e-19
CAB03715 Dau c 1.0103 154 365 85.9 5.5e-19
Q5ULZ4 Fra a 1.0101 100 255 62.8 3.2e-12
P85126 Que a 1.0101 50 220 55.8 2.1e-10
Q9ZWP8 Vig r 6.0101 155 207 52.4 6.7e-09
Q9S8Q4 Cas s 1 24 114 33.7 0.00043
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 228.6 bits 1038,  Expect = 7e-62
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 217.1 bits 984,  Expect = 2e-58
 Identities = 150/160 93%, Positives = 157/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGGSIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 216.9 bits 983,  Expect = 2e-58
 Identities = 151/160 94%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK+VATPDGGSIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 216.7 bits 982,  Expect = 2e-58
 Identities = 150/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGGSIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 5. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 215.4 bits 976,  Expect = 6e-58
 Identities = 150/160 93%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG+PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK+VATPDGGSIL+ISNK
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 6. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 214.6 bits 972,  Expect = 1e-57
 Identities = 148/160 92%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 7. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 214.6 bits 972,  Expect = 1e-57
 Identities = 150/160 93%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK+VATPDGGSIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE  E LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 8. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 214.1 bits 970,  Expect = 1e-57
 Identities = 148/160 92%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 9. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 214.1 bits 970,  Expect = 1e-57
 Identities = 149/160 93%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKLVATPDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHEMKAEHMKAIKEK EALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 10. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 213.9 bits 969,  Expect = 2e-57
 Identities = 147/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 11. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 212.9 bits 964,  Expect = 3e-57
 Identities = 147/160 91%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD LEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 12. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 212.7 bits 963,  Expect = 4e-57
 Identities = 147/159 92%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE+ETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIKLVATPDGGSIL+ISNKY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGDHEMKAEHMKAIKEKGE LLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 13. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 212.7 bits 963,  Expect = 4e-57
 Identities = 145/160 90%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDGDNL+PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 14. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 212.4 bits 962,  Expect = 5e-57
 Identities = 147/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 15. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 212.4 bits 962,  Expect = 5e-57
 Identities = 146/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIK+VATP+GGSIL+I+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 16. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 212.2 bits 961,  Expect = 5e-57
 Identities = 145/160 90%, Positives = 156/160 97%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GDNLIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 17. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 211.8 bits 959,  Expect = 7e-57
 Identities = 146/160 91%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 18. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 211.2 bits 956,  Expect = 1e-56
 Identities = 145/160 90%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIK+VATP+GGSIL+I+NK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 19. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 211.0 bits 955,  Expect = 1e-56
 Identities = 143/160 89%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAAR+FKAFILDGD L+PKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 20. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 210.7 bits 954,  Expect = 2e-56
 Identities = 146/160 91%, Positives = 154/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
             G+PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIK+VATPDGG +L+ISNK
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+HE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 21. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 210.1 bits 951,  Expect = 2e-56
 Identities = 147/160 91%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EGFPFKYVKDRVDEV H NFKY+YSVIEGGPIGDTLEKISNEIK+VATPDG SIL+ISNK
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 209.9 bits 950,  Expect = 3e-56
 Identities = 145/160 90%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE+ETTSVIPAARLFKAFIL+GD LIPKVAPQAISSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD+EMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 209.3 bits 947,  Expect = 4e-56
 Identities = 144/159 90%, Positives = 152/159 95%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFPE
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G PFKYVKDRVDEVDH NFKY+YS+IEGGP+GDTLEKISNEIK+VATPDGGSIL+ISNKY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 24. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 208.8 bits 945,  Expect = 6e-56
 Identities = 144/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPAARLFKAFILDGDNL PKVAPQAISSVENIEGNGGPGTIKKISFP
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK RVDEVDHTNFKY+YSVIEGGP+GDTLEKISNEIK+VATP+GGSIL+I+NK
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+KAE++KA KE GE LLRAVESYLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 198.9 bits 898,  Expect = 5e-53
 Identities = 137/150 91%, Positives = 146/150 97%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYE+ETTSVIPAARLFKAFIL+GDNLIPKVAPQAISSVENIEGNGGPGTIKKI+FPEG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHT 123
            PFKYVK+RVDEVDH NFKY+YS+IEGG +GDTLEKI NEIK+VATPDGGSIL+ISNKYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 153
            KGDHEMKAEHMKAIKEKGEALLRAVESYLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 26. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 198.1 bits 894,  Expect = 9e-53
 Identities = 136/150 90%, Positives = 145/150 96%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPEGF 63
            FNYETETTSVIPAARLFKAFILDGDNL PKVAPQAISSV+NIEGNGGPGTIKKI+FPEGF
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   PFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHT 123
            PFKYVKDRVDEVDHTNFKYNYSVIEGGP+GDTLEKISNEIK+VATPDGG IL+ISNKYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 153
            KG+HE+KAE++KA KE GE LLRAVESYLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 27. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 198.0 bits 894,  Expect = 1e-52
 Identities = 133/160 83%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE+TSVIPAARLFKAFILDG+NLIPKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RV+EVDHTNFKY+Y+VIEGGP+GD +EKI NEIK+VA PDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+ AEH+K  KEK E L+RAVE+YLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 190.6 bits 859,  Expect = 2e-50
 Identities = 128/160 80%, Positives = 144/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFKYVK+RVDEVD  NFKY++SVIEGG +GD LEK+ NEIK+VA PDGGSIL+ISNK
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +HTKGDHE+ AE++K  KEK   LL+AVESYLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 189.1 bits 852,  Expect = 5e-50
 Identities = 127/159 79%, Positives = 143/159 89%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFKAFILDGD L+PKVAP+A+SSVENIEGNGGPGTIKKI+FPE
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G PFKYVK+RVDEVD  NFKY++SVIEGG +GD LEK+ NEIK+VA PDGGSIL+ISNK+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGDHE+ AE++K  KEK   LL+AVESYLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 30. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 187.9 bits 846,  Expect = 1e-49
 Identities = 125/160 78%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+NLIPKVAPQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGGP+GD +EKI NEIK+VA PDGGSIL+I++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 31. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 182.6 bits 821,  Expect = 5e-48
 Identities = 122/160 76%, Positives = 143/160 89%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P KYVK+RV+EVDHTNFKY+Y+VIEGG +GD +EKI NEIK+VA PDGGSIL+I++K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+ AEH+K  KE+ E LL+ VE+YLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 32. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 177.7 bits 798,  Expect = 1e-46
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 33. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 177.5 bits 797,  Expect = 2e-46
 Identities = 118/160 73%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 34. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 176.2 bits 791,  Expect = 4e-46
 Identities = 118/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSIL+IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 35. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 176.0 bits 790,  Expect = 4e-46
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ETTSVIPAARLFKAFILDG+ LIPKV+PQA+SSVEN+EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G P KYVK+RV+E+DHTNFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG HE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 36. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 175.3 bits 787,  Expect = 7e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 37. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 175.3 bits 787,  Expect = 7e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 38. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 175.1 bits 786,  Expect = 8e-46
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGS+++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 39. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 175.1 bits 786,  Expect = 8e-46
 Identities = 117/160 73%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAIS VEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSIL+IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 40. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 174.9 bits 785,  Expect = 9e-46
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 41. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 174.7 bits 784,  Expect = 1e-45
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKY+Y+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 174.1 bits 781,  Expect = 2e-45
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE E TSVI  ARLFK+F+LD DNLIPKVAP+ +SS ENIEGNGGPGTIKKI+FP
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  FKY+K RVDE+DH NFKY YS+IEGGP+GDTLEKIS EIK+VA P GGSIL+I++K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD  +  E +KA KEKG  L++AVE+YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 173.2 bits 777,  Expect = 3e-45
 Identities = 116/160 72%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 44. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 172.8 bits 775,  Expect = 4e-45
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 172.0 bits 771,  Expect = 7e-45
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ETTSVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE +K  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 171.7 bits 770,  Expect = 8e-45
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 47. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 171.5 bits 769,  Expect = 1e-44
 Identities = 115/159 72%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG HE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 48. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 171.1 bits 767,  Expect = 1e-44
 Identities = 114/159 71%, Positives = 134/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQ ISSVEN+ GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G PFK+VK+RVDEVD+ NFKYNY+VIEG  +GD LEK+S+E+K+VA P GGSI++IS+K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KG HE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 49. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 170.3 bits 763,  Expect = 2e-44
 Identities = 114/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 50. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 170.3 bits 763,  Expect = 2e-44
 Identities = 115/160 71%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVIPAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+K+VA P GGSIL+IS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 51. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 168.1 bits 753,  Expect = 1e-43
 Identities = 113/160 70%, Positives = 133/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SV+PAARLFK+++LD D LIPKVAPQAISSVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PFK+VK+RVDEVD+ NFK++Y+VIEG  +GD LEK+S E+ +VA P GGSIL+IS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVESYLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 52. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 167.7 bits 751,  Expect = 1e-43
 Identities = 113/160 70%, Positives = 134/160 83%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYE ET SVI AARLFK+++LDGD LIPKVAPQAI+SVEN+ GNGGPGTIK I+F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +KYVK+RVDEVD+TNFKY+Y+VIEG  +GD LEK+ +E+K+VA P GGS L+IS+K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 166.4 bits 745,  Expect = 3e-43
 Identities = 113/160 70%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIP ARLFK F+LD DNLIPKVAP+AI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG PF Y+K +V+E+D+ NF Y YSVIEG  + D LEKI+ EIK+VA+P GGSIL+  +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHT GDHE+K E++KA KEK   L++AVE YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 161.4 bits 721,  Expect = 1e-41
 Identities = 109/159 68%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNLIPKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGG-SILEISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG SIL+I++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 55. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 160.7 bits 718,  Expect = 2e-41
 Identities = 108/159 67%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNLIPKVAPQ  +S EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGG-SILEISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKI  EIK+ A P GG SIL+I++
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 56. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 160.1 bits 715,  Expect = 3e-41
 Identities = 107/159 67%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF+YE E TSVIP ARLFK+F+LD DNLIPKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGG-SILEISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG SIL+I++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 159.4 bits 712,  Expect = 4e-41
 Identities = 107/159 67%, Positives = 128/159 80%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARLFK+F+LD DNLIPKVAPQ  +  EN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGG-SILEISN 119
            EG  FKY+K +V+E+DH NFKY YS+IEGGP+G TLEKIS EIK+ A P GG SIL+I++
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KYHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            KYHTKG+  +  E +KA KEK   L++AVE+YLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 159.0 bits 710,  Expect = 6e-41
 Identities = 107/160 66%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETETTSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E KL+A+PDGGSI++ ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 159.0 bits 710,  Expect = 6e-41
 Identities = 108/160 67%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS IP  RLFKAF+LD DNLIPK+AP+AI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  FKYVK R+DE+D+ NF Y YSVIEG  + + LEKIS EIK+VA+PDGGSIL+ ++K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG++E+K E + A KEK   L++AVE+YLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 156.3 bits 697,  Expect = 4e-40
 Identities = 105/160 65%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNLIPK+APQAI S + IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E KL+A+PDGGSI++ ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 155.4 bits 693,  Expect = 7e-40
 Identities = 105/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E KL+A+PDGGSI++ ++ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y  KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 155.4 bits 693,  Expect = 7e-40
 Identities = 106/160 66%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE+TSVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +KYVK R D +D  NF Y YSVIEG  + D +EKIS E K+VA+ +GGSIL+  + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH+KGDHE+K E +K  KEK   L++AVE YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 63. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 154.6 bits 689,  Expect = 1e-39
 Identities = 105/160 65%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+ETT+VI  ARLFKAF+LD DNLIPKVAPQAI S E IEG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  F YVK R+DE+D+ NF Y  ++IEG  I +TLEKI+ EIKLVA+PDGGSIL+ ++K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGDHE+K +++KA KE+   +++AVE+YLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 64. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 148.2 bits 659,  Expect = 1e-37
 Identities = 96/160 60%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D +D  N+ Y+Y++IEG  +GDTLEKIS E KLVA+P GGSI++ ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 147.4 bits 655,  Expect = 2e-37
 Identities = 96/160 60%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D +D  N  Y+Y++IEG  +GD LEKIS E KLVA+P GGSI++ ++ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 146.7 bits 652,  Expect = 3e-37
 Identities = 102/159 64%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVFNYETE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA+   GS+++ ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTK D E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 67. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 143.8 bits 638,  Expect = 2e-36
 Identities = 99/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA+   GS+++ ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 68. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 143.6 bits 637,  Expect = 3e-36
 Identities = 99/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA    GS+++ ++ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 69. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 143.6 bits 637,  Expect = 3e-36
 Identities = 96/160 60%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YETE TSVIP  +LFKAFILD DNLIPKVAP A+   E +EG+GG GTIKK++F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK RVD +D  N+ Y+Y++IEG  + D +E I+ +IKLVA+PDGGSI++ ++ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K E++KA KEK   L++ VE+YLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 70. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 142.5 bits 632,  Expect = 5e-36
 Identities = 94/159 59%, Positives = 122/159 76%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E K+VA+PDGGSI++ ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 71. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 140.6 bits 623,  Expect = 2e-35
 Identities = 99/159 62%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE E TSVIP ARL+ AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  NF Y YSVIEG  I +T+EKIS E KLVA+  G  I  IS+ 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 72. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 139.5 bits 618,  Expect = 4e-35
 Identities = 92/159 57%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  YE+E  SVIP ARLFKAF+LD DNLIPKV PQA+ S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +K+ K R+D +D  NF +++SVIEG  + D LE +S E K+VA+PDGGSI++ + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 73. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 139.5 bits 618,  Expect = 4e-35
 Identities = 91/160 56%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG+F Y  E+TSVIP  RLFKA++L+ D LIPK+APQ++ S E +EG+GG GTIKKISF 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D +D  NF YNYS++EG  + D +EKIS EIKLVA+ DGGS+++ ++ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K E +KA KEK   L++ +E+YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 74. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 139.3 bits 617,  Expect = 5e-35
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 75. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 139.1 bits 616,  Expect = 6e-35
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG++ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK RVD +D  ++ Y Y++IEG  + DT+EKIS E KLVA+  G +I  IS+ 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 76. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 138.9 bits 615,  Expect = 6e-35
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 77. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 138.7 bits 614,  Expect = 7e-35
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YH KG+ E+K EH+K  KEKG  L++ +ESYL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 78. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 138.5 bits 613,  Expect = 9e-35
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 79. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 138.5 bits 613,  Expect = 9e-35
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 138.5 bits 613,  Expect = 9e-35
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 81. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 138.0 bits 611,  Expect = 1e-34
 Identities = 93/159 58%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+NYE++ TSVIP ARLFKAF+LD DNLI KV P+A+ S E IEGNGGPGTIKK +F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    KY K R+D +D  N  Y++SVIEG  + D +  IS E+K+VA+PDGGSI++ + K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y+TKG  ++K E+++A  EKG  L++AVE+YLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 137.8 bits 610,  Expect = 1e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA K K   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 137.8 bits 610,  Expect = 1e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+K  KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 137.6 bits 609,  Expect = 2e-34
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 137.6 bits 609,  Expect = 2e-34
 Identities = 93/159 58%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+E IS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 137.6 bits 609,  Expect = 2e-34
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KL+A+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 137.4 bits 608,  Expect = 2e-34
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFK F+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 88. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 137.4 bits 608,  Expect = 2e-34
 Identities = 90/160 56%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P GG+I++ ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 89. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 137.2 bits 607,  Expect = 2e-34
 Identities = 95/158 60%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E++ TSVIP ARLFKAF+LD DNLIPKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK+VA+PDGGSI + + K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 90. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 137.2 bits 607,  Expect = 2e-34
 Identities = 92/159 57%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ES+L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 91. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 137.2 bits 607,  Expect = 2e-34
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGT KKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 92. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 137.0 bits 606,  Expect = 2e-34
 Identities = 88/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P GG++++ ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 93. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 136.8 bits 605,  Expect = 3e-34
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+ A KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 136.6 bits 604,  Expect = 3e-34
 Identities = 93/159 58%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E TS IP +RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKG+ E+K EH+K  KEK   L++ +ESYL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 95. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 136.1 bits 602,  Expect = 4e-34
 Identities = 88/160 55%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + + +EKI  E KLV+ P GG+I++ ++K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 96. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 135.7 bits 600,  Expect = 6e-34
 Identities = 92/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GV+ YE E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
            G  + YVK ++D VD  N+ Y Y++IEG  + DT+EK+S E KLVA+   GSI++  + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            HTKGD E+  EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 97. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 135.5 bits 599,  Expect = 7e-34
 Identities = 89/160 55%, Positives = 115/160 71%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG + YE E TS IPA +LFKAF+LD DNLIPK+APQAI   E +EG+GGPGTIKKI+F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P GG+I++ ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 98. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 134.4 bits 594,  Expect = 1e-33
 Identities = 93/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E   FKY K R+D +D  N  Y++SVIEG  +   +E +S EIK VA+PDGGSI++ + K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++K E+++A  EK   LL+AVE+YL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 99. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 134.2 bits 593,  Expect = 2e-33
 Identities = 91/159 57%, Positives = 119/159 74%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  +K+ K R+D +D  NF Y++SVIEG  + D LE +S E K+VA+PDGGSI + ++K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            Y+TKGD ++  E ++  KEK   +++AVE+YL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 100. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 133.0 bits 587,  Expect = 4e-33
 Identities = 88/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV+ YE E TS IPA +LFKAF+LD DNLIPK+APQA+   E +EG+GGPGTIKKI+F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG  + YVK ++  +D  N  Y+YS+IEG  + D +EKI  E KLV+ P G +I++ ++K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            YHTKGD E+K EH+KA KEK   L++ +E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 101. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 132.7 bits 586,  Expect = 5e-33
 Identities = 85/160 53%, Positives = 123/160 76%, Gaps = 1/160 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF YE+E TS I  ARLFKAF+LDGDNL+PK+APQA+  VE +EGNGG GTIKKI+F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPI-GDTLEKISNEIKLVATPDGGSILEISN 119
            +G PFKYVK +++ +D  ++ Y+YS+IEG  + G+ LEKI++E KLVA+ DGG++++  +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KYHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            KY++ GD ++  E +K  +++   +L+ VE+YL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 102. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 114.9 bits 502,  Expect = 1e-27
 Identities = 80/158 50%, Positives = 111/158 70%, Gaps = 2/158 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E  S +  A L+KA++ D DN+IPK A  +  SVEN+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    K+V  +++ +D  N+ Y+YSV+ G  + DT EKI+ + KLVA P+GGS  +++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160
            Y TKGD E   + +K  K K +AL++A+E+YLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 103. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 114.7 bits 501,  Expect = 1e-27
 Identities = 77/157 49%, Positives = 109/157 69%, Gaps = 0/157 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IK+VA PDGGSI +  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 112.6 bits 491,  Expect = 5e-27
 Identities = 77/156 49%, Positives = 106/156 67%, Gaps = 1/156 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG   Y+ E  S I A ++FKAF+LDGD +IPK  P+AI+ V+ +EG+GG GTIK  +F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG   K VK R+D +D  NF Y+YS+IEGG + D +E IS  IK+VATPDGG I +  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157
            Y  K D ++  E +KA KE+   +++ VE+YLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 111.4 bits 485,  Expect = 1e-26
 Identities = 75/135 55%, Positives = 100/135 74%, Gaps = 1/135 0%
Query  11   TSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKD 70
            TSVIP  +LFKAF+LD DNLIPK+APQA+ SVE IEG+GG GT+KKI + EG    YVK 
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHTKGDHEMK 130
            ++D +D  NF Y+YS+ EG  +GD +EKIS EIKLVA+   GSI++ ++ YH KG  E+K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  AEHMKAIKEKGEALLR 146
             E++K  KE+   L++
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 109.7 bits 477,  Expect = 4e-26
 Identities = 73/154 47%, Positives = 108/154 70%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF +E +TTS +  A L+KA++ D D ++PK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    K+V  +++E+D  N+ Y+YS++ G  + DT EKIS + KL   P+GGS++++S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH+KGD     + +KA K K +AL++ +E+YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 107. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 109.4 bits 476,  Expect = 5e-26
 Identities = 75/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E KLV  P+GGSI +++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 107.1 bits 465,  Expect = 2e-25
 Identities = 71/155 45%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + KL   P+GGS++++S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 106.5 bits 462,  Expect = 4e-25
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK+ A  +GG + + + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGDH +  E     +E+   + +AVE+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 105.6 bits 458,  Expect = 6e-25
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + KL   P+GGS++++S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 105.6 bits 458,  Expect = 7e-25
 Identities = 67/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K+ A  DGG + + + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159
            YHTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 102.9 bits 445,  Expect = 4e-24
 Identities = 66/153 43%, Positives = 104/153 67%, Gaps = 2/153 1%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +E E+TS +P A+LFKA ++DGD L PK+ P AI S+E +EGNGGPGT+KK++  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E     YV  ++D +D   + Y+Y++  G    + LEK+S + KL A  DGGS +++S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E  + +K+K + +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 101.0 bits 436,  Expect = 2e-23
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            M VF ++ + TS +  A L+ A+  D DN+IPK A  +  SVE +EGNGGPGTIKKISF 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E    K+V  +++ VD  N+ Y+YS++ G  + DT EKI+ + K+    DGGS+++++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            YH KGD     + +KA K K +AL++AVE+YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 114. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 97.2 bits 418,  Expect = 2e-22
 Identities = 65/154 42%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  +  E TS + A ++F+ F++D D ++PK AP A  SVE I+G+GGPGT+K I++P
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            +G P   +  R+D V+   + ++YSVI+G  +   +E I N + LV T DGGSI + +  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 115. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 96.4 bits 415,  Expect = 4e-22
 Identities = 63/142 44%, Positives = 96/142 67%, Gaps = 1/142 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q + + E IEG+GG G+IK+++F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P KY+K ++  +D  N++  YS+IEG  +G+ LE I+ +IK+ A  +GG + + + +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHEM-KAEHMKAIKEKGE 142
            YHTKGDH + + EH    +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 116. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 92.7 bits 397,  Expect = 5e-21
 Identities = 60/155 38%, Positives = 100/155 64%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E   TS +PAA+LFKA+ LD D L+P+V P AI   E +EG+GG GT+K +++ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            +  P+K +K ++D +D   F ++YS+I+G  +   ++ I+N + +V T DGG     +  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            ++TKGD  +  E++K   ++   +++AVE+YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 117. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 91.2 bits 390,  Expect = 1e-20
 Identities = 54/152 35%, Positives = 97/152 63%, Gaps = 0/152 0%
Query  7    ETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFK 66
            E E TS +  + +FKAF++D D + PK  P+   S++ IEG+GG GTIK I++ +G PF 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHTKGD 126
              K +VD +D  NF  +Y++ EG  +   +E  ++ +K++ + DGGS+ + S  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  HEMKAEHMKAIKEKGEALLRAVESYLLAHSDA 158
             ++  E++  +KE  +  ++A+E+Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 118. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 88.7 bits 378,  Expect = 8e-20
 Identities = 59/154 38%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI + +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K   E+  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 88.7 bits 378,  Expect = 9e-20
 Identities = 61/154 39%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV     E  S + A ++++ F+LD D + PKV PQ I SVE +EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + D LE + NE  +V T DGG I++ +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            Y+TKGD  +  + +K   EK    ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 88.0 bits 375,  Expect = 1e-19
 Identities = 59/154 38%, Positives = 96/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI + +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 87.8 bits 374,  Expect = 1e-19
 Identities = 58/154 37%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI + +  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 87.4 bits 372,  Expect = 2e-19
 Identities = 58/154 37%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A  SV+ ++G+GG GT++ I++P
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P   +  R D V+   + Y+ +VI+G  + + +E I   + +V T DGGSI + +  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 123. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 87.0 bits 370,  Expect = 3e-19
 Identities = 59/154 38%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MGV   E E  S + A ++++ F+LD D + PKV PQ I SVE +EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E   +  +K +VD +D   + Y Y+ I G  + + LE + N+  +V T DGG I++ +  
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            Y+TKGD  +  + +K   EK    ++AVE+YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 85.9 bits 365,  Expect = 5e-19
 Identities = 58/154 37%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
            MG  ++  E TS + A ++F   +LD D +IPK A  A  SVE ++G+GG GT++ I++P
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            EG P   +  R D V+   + Y+ +VI+G  +   +E I   + +V T DGGSI + +  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155
            +HTKGD  +  E++K    +  AL++A+E+YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.8 bits 255,  Expect = 3e-12
 Identities = 55/100 55%, Positives = 71/100 71%, Gaps = 39/100 39%
Query  22   AFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFK 81
            AF+LD DNLIPK                      KI+F EG  + YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKAIKEKG 141
                 +EG  + DTLEKI  E KLV+ P   +I++ ++KYHTKGD E+K EH+KA KEK 
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  EALLRAVESYLLAHSDAYN 160
              L++ +E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 55.8 bits 220,  Expect = 2e-10
 Identities = 35/50 70%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGP 51
            GVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 52.4 bits 207,  Expect = 7e-09
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  4    FNYETETTSVIPA--ARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
            FN +TE +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
            E  P  Y ++ + E D ++ +    VIEGG +   L       KL    +  +++ +   
Sbjct  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
Query  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 152
            Y    D E K    K   +     LR +E YL
Sbjct  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 33.7 bits 114,  Expect = 0.0004
 Identities = 17/24 70%, Positives = 21/24 87%, Gaps = 0/24 0%
Query  2    GVFNYETETTSVIPAARLFKAFIL 25
            GVF +E++ TSVIP ARLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.