The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG
EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH
YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA96535 Mal d 1.0401 160 1022 259.7 2.7e-71
CAA96536 Mal d 1.0402 160 1005 255.5 5e-70
CAA96537 Mal d 1.0403 160 1005 255.5 5e-70
O50001 Pru ar 1 160 848 216.7 2.4e-58
Q2I6V8 Pru p 1.0101 160 840 214.7 9.6e-58
O24248 Pru av 1 160 838 214.2 1.3e-57
CAA96534 Mal d 1.0301 159 814 208.3 8.2e-56
B6CQS9 Pru du 1.0101 160 809 207.1 1.9e-55
AAK13027 Mal d 1.0302 159 803 205.6 5.4e-55
AAO25113 Mal d 1.0304 159 800 204.8 9e-55
APD76154 Jug r 5.0101 160 795 203.6 2.1e-54
Q256S7 Fra a 1 160 795 203.6 2.1e-54
AAK13028 Mal d 1.0303 159 793 203.1 3e-54
Q3T923 Fra a 1 160 793 203.1 3e-54
Q256S6 Fra a 1 160 786 201.4 1e-53
AAD26545 Mal d 1.0202 159 783 200.6 1.7e-53
AAB01362 Mal d 1.0201 159 783 200.6 1.7e-53
AAD26548 Mal d 1.0204 159 781 200.1 2.3e-53
AAD13683 Mal d 1.0206 159 778 199.4 3.9e-53
Q256S2 Fra a 1 160 778 199.4 3.9e-53
AAD26547 Mal d 1.0203 159 777 199.2 4.6e-53
AAK13030 Mal d 1.0207 159 777 199.2 4.6e-53
AAD26558 Mal d 1.0205 159 775 198.7 6.5e-53
Q256S4 Fra a 1 159 774 198.4 7.8e-53
CAD32318 Mal d 1.0208 158 770 197.4 1.5e-52
CAA96549 Cor a 1.0301 160 768 196.9 2.2e-52
CAD10374 Cas s 1 160 763 195.7 5.2e-52
AAD26552 Mal d 1.0104 159 761 195.2 7.2e-52
O65200 Pyr c 1 159 760 194.9 8.6e-52
AAD26546 Mal d 1.0103 159 752 193.0 3.4e-51
ACJ23864 Fag s 1.0101 160 751 192.7 4e-51
AAD29671 Mal d 1.0108 159 750 192.5 4.7e-51
CAA58646 Mal d 1.0101 159 745 191.2 1.1e-50
AAD26555 Mal d 1.0107 159 745 191.2 1.1e-50
AAD26553 Mal d 1.0105 159 744 191.0 1.3e-50
AAD26554 Mal d 1.0106 159 744 191.0 1.3e-50
Q39427 Bet v 1.0205 160 743 190.7 1.6e-50
AAK13029 Mal d 1.0109 159 739 189.8 3.1e-50
CAA88833 Mal d 1.0102 159 738 189.5 3.7e-50
CAA96548 Cor a 1.0201 160 737 189.3 4.5e-50
P43186 Bet v 1.0204 160 732 188.0 1e-49
CAA04828.1 Bet v 1.0206 159 726 186.5 2.9e-49
CAA54421 Bet v 1.0201 160 722 185.5 5.8e-49
CAA54481 Bet v 1.0202 160 720 185.0 8.2e-49
P43184 Bet v 1.0203 160 719 184.8 9.7e-49
CAA07329.1 Bet v 1.0118 160 710 182.6 4.6e-48
CAB02217 Car b 1.0302 161 709 182.3 5.5e-48
ABZ81046 Que a 1.0301 160 707 181.8 7.6e-48
CAB02160 Bet v 1.0113 160 703 180.8 1.5e-47
CAA50325 Cor a 1.0103 160 701 180.4 2.1e-47
AUH28179 Que m 1.0101 160 700 180.1 2.5e-47
CAB02159 Bet v 1.0112 160 698 179.6 3.6e-47
CAA33887 Bet v 1.0101 160 698 179.6 3.6e-47
CAB02156 Bet v 1.0109 160 697 179.4 4.2e-47
CAB02216 Car b 1.0301 161 697 179.4 4.3e-47
CAB02161 Bet v 1.0114 160 696 179.1 5e-47
CAA50327 Cor a 1.0101 160 692 178.1 1e-46
CAA04827.1 Bet v 1.0116 159 690 177.6 1.4e-46
AAB24432 Aln g 1 160 690 177.6 1.4e-46
CAA54696.1 Bet v 1.0301 160 687 176.9 2.4e-46
CAA54487 Bet v 1.0106 160 687 176.9 2.4e-46
Q08407 Cor a 1 159 685 176.4 3.3e-46
CAA07323.1 Bet v 1.0117 160 685 176.4 3.3e-46
CAA54483 Bet v 1.0103 160 685 176.4 3.3e-46
CAB02155 Bet v 1.0108 160 684 176.1 3.9e-46
P38948 Aln g 1 159 683 175.9 4.6e-46
CAB02157 Bet v 1.0110 160 683 175.9 4.7e-46
CAA50328 Cor a 1.0102 160 682 175.7 5.5e-46
CAA54484 Bet v 1.0104 160 681 175.4 6.6e-46
CAA54482 Bet v 1.0102 160 680 175.2 7.8e-46
CAA96547 Bet v 1.0115 160 680 175.2 7.8e-46
CAA54485 Bet v 1.0105 160 678 174.7 1.1e-45
ABZ81047 Que a 1.0401 160 676 174.2 1.5e-45
CAB02158 Bet v 1.0111 160 676 174.2 1.5e-45
CAA54489 Bet v 1.0107 160 672 173.2 3.1e-45
CAB02206 Car b 1.0103 160 667 171.9 7.2e-45
CAB02207 Car b 1.0104 160 661 170.5 2e-44
AFN42528 Can s 5.0101 161 661 170.5 2e-44
AAD48405 Cor a 1.0401 161 660 170.2 2.4e-44
AAG40331 Cor a 1.0404 161 660 170.2 2.4e-44
ACF75030.1 Bet v 1.0207 150 658 169.8 3.1e-44
P38950 Car b 1 159 657 169.5 4e-44
ABZ81043 Car b 1.0112 160 657 169.5 4e-44
ABZ81042 Car b 1.0111 160 657 169.5 4e-44
AAG40329 Cor a 1.0402 161 657 169.5 4.1e-44
CAA50326 Cor a 1.0104 160 656 169.2 4.8e-44
ABZ81041 Car b 1.0110 160 656 169.2 4.8e-44
Q0Z8U9 Rub i 1.0101 137 654 168.9 5.2e-44
CAB02208 Car b 1.0105 160 655 169.0 5.7e-44
ABZ81040 Car b 1.0109 160 655 169.0 5.7e-44
AAG40330 Cor a 1.0403 161 654 168.7 6.8e-44
ABZ81044 Car b 1.0113 160 653 168.5 8e-44
ADK39021 Ost c 1.0101 160 650 167.7 1.3e-43
QOL10866 Que ac 1.0101 159 646 166.8 2.6e-43
CAB02209 Car b 1.0106 160 645 166.5 3.1e-43
CAA47357 Car b 1.0102 159 639 165.0 8.7e-43
CAB02213 Car b 1.0107 160 635 164.0 1.7e-42
CAM31908 Act c 8.0101 159 630 162.8 4.1e-42
ABZ81045 Que a 1.0201 159 630 162.8 4.1e-42
QGS84240 Que i 1.0101 159 628 162.3 5.7e-42
P38949 Car b 1 159 626 161.8 8.1e-42
CAB02215 Car b 1.0108 160 625 161.6 9.7e-42
ABC41615.1 Bet v 1.0119 150 611 158.1 9.6e-41
CAM31909 Act d 8.0101 157 590 152.9 3.8e-39
NP_001275580 Sola l 4.0201 160 510 133.1 3.5e-33
AHC08073 Sola l 4.0101 160 504 131.6 9.9e-33
CAA42646 Gly m 4 158 498 130.2 2.7e-32
CAA43637 Pha v 1 156 482 126.2 4.1e-31
P25985 Pha v 1 155 475 124.5 1.4e-30
CAA43636 Pha v 1 155 472 123.7 2.3e-30
AAQ91847 Ara h 8.0101 157 472 123.7 2.3e-30
CAA67246 Pet c PR10 155 466 122.3 6.3e-30
CAA75803 Lyc e 4.0101 178 457 119.9 3.7e-29
P92918 Api g 1.0201 159 452 118.8 7.3e-29
AAL76932 Dau c 1.0201 154 448 117.8 1.4e-28
Q2VU97 Vig r 1.0101 155 448 117.8 1.4e-28
EF436550 Ara h 8.0201 153 447 117.6 1.6e-28
P49372 Api g 1 154 436 114.8 1.1e-27
AAB92255 Tar o RAP 157 417 110.1 2.9e-26
CAB03716 Dau c 1.0104 154 407 107.7 1.5e-25
CAB06416 Dau c 1.0105 154 404 106.9 2.6e-25
BAA13604 Dau c 1.0102 154 401 106.2 4.3e-25
AAB01092 Dau c 1.0101 168 399 105.6 7e-25
CAB03715 Dau c 1.0103 154 388 103.0 4e-24
Q5ULZ4 Fra a 1.0101 100 348 93.5 1.9e-21
P85126 Que a 1.0101 50 217 61.7 3.6e-12
Q9ZWP8 Vig r 6.0101 155 189 53.8 2.7e-09
Q9S8Q4 Cas s 1 24 108 35.3 0.00014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 259.7 bits 1022,  Expect = 3e-71
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 2. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 255.5 bits 1005,  Expect = 5e-70
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIPAPRLFKAFILDGDNLIPKIAPQAIKST+IIEGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKT SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 3. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 255.5 bits 1005,  Expect = 5e-70
 Identities = 158/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            Y AKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 4. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 216.7 bits 848,  Expect = 2e-58
 Identities = 127/160 79%, Positives = 145/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YETE TSVIP  +LFKAFILD DNLIPK+AP A+K TEI+EGDGGVGTIKKVTFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQY YVK+RV+GIDKDN++YSY++IEGD LSD +E I Y+ KL+ASPDGGSI+KTTSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEE+VKAGKEKA+GLFKL+EAYLLA+ DAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 5. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 214.7 bits 840,  Expect = 1e-57
 Identities = 123/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E TS IP PRLFKAF+LD DNL+PKIAPQAIK +EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ IDK+N +YSY++IEGD L D LEKI+YETKL+ASP GGSIIK+TSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H DAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 214.2 bits 838,  Expect = 1e-57
 Identities = 122/160 76%, Positives = 142/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E TS IP PRLFKAF+LD DNL+PKIAPQAIK +EI+EGDGG GTIKK+TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ IDK+N++YSY++IEGD L D LEKI+YETKL+ASP GGSIIK+TSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+VEIKEEHVKAGKEKAS LFKL+E YL  H DAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 208.3 bits 814,  Expect = 8e-56
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH K DVEIKEEHVKAGKEKAS LFKL+E YLLAHSDAYN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 8. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 207.1 bits 809,  Expect = 2e-55
 Identities = 115/160 71%, Positives = 144/160 90%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG+F Y  E+TSVIP PRLFKA++L+ D LIPKIAPQ++KS EI+EGDGGVGTIKK++FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+Y YVK++++G+DKDNF Y+YS++EGD LSDK+EKI+YE KL+AS DGGS+IK+TS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEE VKAGKEKA+GLFKL+E YL+A+ DAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 9. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 205.6 bits 803,  Expect = 5e-55
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS Y YVK+R++G+DKDNF Y YS+IEGD +S+ +EKI+YETKL+A+   GS+IK+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 204.8 bits 800,  Expect = 9e-55
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 11. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 203.6 bits 795,  Expect = 2e-54
 Identities = 118/160 73%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YETE+TSVIP  RLFKAF+LD DNLIPK+ PQA+KS+EIIEG+GG GTIKK+ FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQY YVK+R + ID+ NFTY+YS+IEGD L+DK+EKI+YETK++AS +GGSI+K+ SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH+KGD EIKEE VK GKEKASGLFK +E YLLAH DAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 12. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 203.6 bits 795,  Expect = 2e-54
 Identities = 119/160 74%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG+IIKTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 13. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 203.1 bits 793,  Expect = 3e-54
 Identities = 118/159 74%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  RL+ AF+LD DNLIPKIAPQA+KSTEI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS Y YVK++++G+DKDNF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+ SH
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 14. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 203.1 bits 793,  Expect = 3e-54
 Identities = 117/160 73%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG++IKTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 15. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 201.4 bits 786,  Expect = 1e-53
 Identities = 118/160 73%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG + YE E TS IPAP+LFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P GG+IIKTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 16. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 200.6 bits 783,  Expect = 2e-53
 Identities = 114/159 71%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 200.6 bits 783,  Expect = 2e-53
 Identities = 114/159 71%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 200.1 bits 781,  Expect = 2e-53
 Identities = 114/159 71%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 199.4 bits 778,  Expect = 4e-53
 Identities = 113/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFK F+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 199.4 bits 778,  Expect = 4e-53
 Identities = 116/160 72%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+YGYVK++++ IDK N TYSYS+IEGD LS+ +EKI YETKL+++P GG+IIKTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA+ LFKL+E YL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 21. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 199.2 bits 777,  Expect = 5e-53
 Identities = 113/159 71%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E++L  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 199.2 bits 777,  Expect = 5e-53
 Identities = 113/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GT KK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 198.7 bits 775,  Expect = 7e-53
 Identities = 113/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SH
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHV AGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 24. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 198.4 bits 774,  Expect = 8e-53
 Identities = 117/159 73%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ YE E TS IPAP+LFKAF+LD DNLIPKIAPQA+K  EI+EGDGG GTIKK+TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+YGYVK++++ IDK+N TYSYS+IEGD LSD +EKI YETKL+++P G +IIKTTS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 197.4 bits 770,  Expect = 2e-52
 Identities = 113/158 71%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GV+ YE E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EGDGG GTIKK+TFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GSQYGYVK++++ +D+ N++Y+Y++IEGD L+D +EK++YETKL+AS   GSIIK+ SHY
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            H KGDVEI EEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 26. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 196.9 bits 768,  Expect = 2e-52
 Identities = 115/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIP  RLFK F+LD DNLIPK+AP+AIKS EIIEG+GG GTIKK+ F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + Y+KQ+V  ID+ NF+Y YS+IEGD LSDKLEKI YE K++ASP GGSI+K+ S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH  GD E+K+E++KAGKEKASGLFK +E YLLAHSDAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 195.7 bits 763,  Expect = 5e-52
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E E TS IP  RLFKAF+LD DNLIPK+AP+AIKS EIIEG+GG GTIKK+TFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQ+ YVK+R++ ID+ NFTY YS+IEGD +++ LEKI+YE K++ASPDGGSI+K TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ EIKEE V AGKEKA+GLFK +EAYLLAHSDAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 195.2 bits 761,  Expect = 7e-52
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 29. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 194.9 bits 760,  Expect = 9e-52
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG++ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+RV+ ID+ +++Y+Y++IEGD L+D +EKI+YE KL+AS   GS IK+ SH
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD+EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 193.0 bits 752,  Expect = 3e-51
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 31. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 192.7 bits 751,  Expect = 4e-51
 Identities = 112/160 70%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+ETT+VI   RLFKAF+LD DNLIPK+APQAIKS+EIIEG GG GTIKK+TFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQ+ YVK+R++ ID  NFTY+ ++IEGD +S+ LEKI YE KL+ASPDGGSI+K+TS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD EIKE+++KAGKE+ASG+FK +EAYLLA+  AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 32. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 192.5 bits 750,  Expect = 5e-51
 Identities = 111/159 69%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 191.2 bits 745,  Expect = 1e-50
 Identities = 110/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVK GKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 34. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 191.2 bits 745,  Expect = 1e-50
 Identities = 110/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGK KA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 35. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 191.0 bits 744,  Expect = 1e-50
 Identities = 111/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 36. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 191.0 bits 744,  Expect = 1e-50
 Identities = 110/159 69%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +E I+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 37. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 190.7 bits 743,  Expect = 2e-50
 Identities = 114/160 71%, Positives = 132/160 82%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E KL+A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEKA  L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 189.8 bits 739,  Expect = 3e-50
 Identities = 110/159 69%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVK GKEKA GLFKL+E+YL  H DAYN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 39. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 189.5 bits 738,  Expect = 4e-50
 Identities = 108/159 67%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A   G +I K+ SH
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG++EIKEEHVK GKEK  GLFKL+E+YL  H DAYN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 40. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 189.3 bits 737,  Expect = 4e-50
 Identities = 107/160 66%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE+TSVIPA RLFKAFILDG+NLIPK+APQA+ S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+  EH+K GKEK  GLF+ +EAYLLAHSDAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 188.0 bits 732,  Expect = 1e-49
 Identities = 111/160 69%, Positives = 131/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE+ETTSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 186.5 bits 726,  Expect = 3e-49
 Identities = 111/159 69%, Positives = 130/159 81%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE+ETTSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK+TF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E KL+A+PDGGSI+K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            H KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 43. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 185.5 bits 722,  Expect = 6e-49
 Identities = 110/160 68%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFIL+GD LIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 185.0 bits 720,  Expect = 8e-49
 Identities = 109/160 68%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE+ETTSVIPA RLFKAFIL+GD LIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 184.8 bits 719,  Expect = 1e-48
 Identities = 109/160 68%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE+ETTSVIPA RLFKAFIL+GD LIPK+APQAI S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 182.6 bits 710,  Expect = 5e-48
 Identities = 107/160 66%, Positives = 130/160 81%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNLIPK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E KL+A+PDGGSI++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K EH+KA KEK   L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 47. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 182.3 bits 709,  Expect = 5e-48
 Identities = 105/160 65%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ETTSVIPA RLFKAFILDG+NLIPK+APQA+ S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS   YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+  EH+K GKE+  GL+K +EAYLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 48. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 181.8 bits 707,  Expect = 8e-48
 Identities = 103/159 64%, Positives = 132/159 83%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E  SVIP  RLFKAF+LD DNLIPK+ PQA+KSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+  + K+R++ ID +NFTYS+S+IEGD L DKLE ++ ETK++ASPDGGSI+K+TS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            Y+ KGD ++ +E ++ GKEKAS +FK +EAYL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 180.8 bits 703,  Expect = 2e-47
 Identities = 105/160 65%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL+PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 180.4 bits 701,  Expect = 2e-47
 Identities = 103/160 64%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ETTSVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 51. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 180.1 bits 700,  Expect = 3e-47
 Identities = 101/159 63%, Positives = 131/159 82%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  YE+E  SVIP  RLFKAF+LD DNLIPK+ PQA+KSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+  + K+R++ ID +NFT+S+S+IEGD L DKLE ++ ETK++ASPDGGSI+K+T  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            Y+ KGD ++ +E ++ GKEKASG+FK +EAYL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 52. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 179.6 bits 698,  Expect = 4e-47
 Identities = 105/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 179.6 bits 698,  Expect = 4e-47
 Identities = 105/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 179.4 bits 697,  Expect = 4e-47
 Identities = 105/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 179.4 bits 697,  Expect = 4e-47
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ETTSVIPA RLFKAFILDG+ LIPK++PQA+ S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS   YVK+RV  +D  NF YSY++IEG  + DK+EKI  E K++A+PDGGSI+K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+  EH+K GKE+  GL+K +EAYLLAH+  YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 179.1 bits 696,  Expect = 5e-47
 Identities = 105/160 65%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 178.1 bits 692,  Expect = 1e-46
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 177.6 bits 690,  Expect = 1e-46
 Identities = 104/159 65%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            G  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+PDGGSI+K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            H KGD E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 59. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 177.6 bits 690,  Expect = 1e-46
 Identities = 102/160 63%, Positives = 129/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFKAFILDGD L+PK+AP+A+ S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + YVK+RV+ +D+ NF YS+S+IEG  + D LEK+  E K++A+PDGGSI+K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +H KGD EI  E++K  KEKA GL+K +E+YLLAHSDAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 176.9 bits 687,  Expect = 2e-46
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE E TSVI   RLFK+F+LD DNLIPK+AP+ + S E IEG+GG GTIKK+TF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS++ Y+K+RV+ ID  NF Y YS+IEG  L D LEKI+YE K++A+P GGSI+K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD+ + EE +KAGKEK +GLFK +E YL+AH +AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 176.9 bits 687,  Expect = 2e-46
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 176.4 bits 685,  Expect = 3e-46
 Identities = 101/159 63%, Positives = 126/159 79%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 63. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 176.4 bits 685,  Expect = 3e-46
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 176.4 bits 685,  Expect = 3e-46
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 176.1 bits 684,  Expect = 4e-46
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 175.9 bits 683,  Expect = 5e-46
 Identities = 101/159 63%, Positives = 128/159 80%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE ET SVIPA RLFKAFILDGD L+PK+AP+A+ S E IEG+GG GTIKK+TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GS + YVK+RV+ +D+ NF YS+S+IEG  + D LEK+  E K++A+PDGGSI+K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            H KGD EI  E++K  KEKA GL+K +E+YLLAHSDAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 67. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 175.9 bits 683,  Expect = 5e-46
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 175.7 bits 682,  Expect = 6e-46
 Identities = 101/160 63%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+Y YVK+RV+ +D  NF YSY++IEGD L DKLEK+  E K++A+P GGSI+K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 175.4 bits 681,  Expect = 7e-46
 Identities = 102/160 63%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE E TSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF YSYS+IEG  + D LEKI+ E K++A+P+GGSI+K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 175.2 bits 680,  Expect = 8e-46
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ETTSVIPA RLFKAFILDGDNL+PK+APQAI S E IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 175.2 bits 680,  Expect = 8e-46
 Identities = 103/160 64%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +   NF YSYS+IEG  + D LEKI+ E K++A+PDG SI+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KGD E+K E++KA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 174.7 bits 678,  Expect = 1e-45
 Identities = 101/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE+ETTSVIPA RLFKAFIL+GDNLIPK+APQAI S E IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 73. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 174.2 bits 676,  Expect = 2e-45
 Identities = 101/159 63%, Positives = 130/159 81%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+  + K+R++ ID +NFTYS+S+IEGD L DKLE ++ ETK++ASPDGGSI K+TS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            Y+ KGD ++ +E ++ GKEKASG+FK +EAYL+AH D Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 74. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 174.2 bits 676,  Expect = 2e-45
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S E IEG+GG GTIKK++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
             G  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 75. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 173.2 bits 672,  Expect = 3e-45
 Identities = 99/160 61%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYETE TSVIPA R+FKAFILDGD L+PK+APQAI S E IEG+GG GTIKK+ F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG ++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            YH KG+ E+K E+VKA KE    L++ +E+YLLAHSDAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 76. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 171.9 bits 667,  Expect = 7e-45
 Identities = 95/160 59%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 77. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 170.5 bits 661,  Expect = 2e-44
 Identities = 94/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L D LEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 78. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 170.5 bits 661,  Expect = 2e-44
 Identities = 96/160 60%, Positives = 132/160 82%, Gaps = 1/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE+E TS I   RLFKAF+LDGDNL+PKIAPQA++  EI+EG+GGVGTIKK+TFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTL-SDKLEKITYETKLIASPDGGSIIKTTS 119
            +G  + YVK+++  IDK+++TYSYS+IEGD L  ++LEKIT+E+KL+AS DGG++IKT S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
             Y++ GD ++ EE VK G+++A+ ++K +EAYL  H +AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 79. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 170.2 bits 660,  Expect = 2e-44
 Identities = 101/159 63%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  RLFK+F+LD DNLIPK+APQ   S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGG-SIIKTTS 119
            EG+++ Y+K++V  ID  NF Y YS+IEG  L   LEKI+YE K+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
             YH KG+  I EE +KAGKEKA+GLFK +EAYLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 80. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 170.2 bits 660,  Expect = 2e-44
 Identities = 101/159 63%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF+YE E TSVIP  RLFK+F+LD DNLIPK+APQ   S E +EG+GG GTIKK+TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGG-SIIKTTS 119
            EG+++ Y+K++V  ID  NF Y YS+IEG  L   LEKI YE K+ A+P GG SI+K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
             YH KG+  I EE +KAGKEKA+GLFK +EAYLLAH DAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 81. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 169.8 bits 658,  Expect = 3e-44
 Identities = 100/150 66%, Positives = 121/150 80%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGS 63
            FNYE+ETTSVIPA RLFKAFIL+GDNLIPK+APQAI S E IEG+GG GTIKK+TF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHA 123
             + YVK+RV+ +D  NF YSYSMIEG  L D LEKI  E K++A+PDGGSI+K ++ YH 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASGLFKLLEAYLL 153
            KGD E+K EH+KA KEK   L++ +E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 82. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 169.5 bits 657,  Expect = 4e-44
 Identities = 97/159 61%, Positives = 124/159 77%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE ETTSVIPA RLFKAFILDG+ LIPK++PQA+ S E +EG+GG GTIKK+TF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GS   YVK+RV  ID  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            HAKG  E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 83. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 169.5 bits 657,  Expect = 4e-44
 Identities = 94/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 169.5 bits 657,  Expect = 4e-44
 Identities = 94/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 85. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 169.5 bits 657,  Expect = 4e-44
 Identities = 100/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF+YE E TSVIP  RLFK+F+LD DNLIPK+APQ     E +EG+GG GTIKK+TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGG-SIIKTTS 119
            EGS++ Y+K++V  ID  NF Y YS+IEG  L   LEKI+YE K+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
             YH KG+  I EE +KAGKEKA+GLFK +EAYLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 86. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 169.2 bits 656,  Expect = 5e-44
 Identities = 98/160 61%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVI A RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS+Y YVK+RV+ +D  NF YSY++IEGD L DKLEK+  E K++A+P GGS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 87. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 169.2 bits 656,  Expect = 5e-44
 Identities = 93/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 88. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 168.9 bits 654,  Expect = 5e-44
 Identities = 97/136 71%, Positives = 119/136 87%, Gaps = 1/136 0%
Query  11   TSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGSQYGYVKQ 70
            TSVIP P+LFKAF+LD DNLIPKIAPQA+KS EIIEGDGGVGT+KK+ +GEG+++ YVK+
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHAKGDVEIK 130
            +++G+DK NF YSYS+ EGD L DK+EKI+YE KL+AS   GSIIKTTSHYH KG  EIK
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  131  EEHVKAGKEKASGLFKL 147
            EE+VK GKE+A+GLFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 89. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 169.0 bits 655,  Expect = 6e-44
 Identities = 94/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 169.0 bits 655,  Expect = 6e-44
 Identities = 94/160 58%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 168.7 bits 654,  Expect = 7e-44
 Identities = 100/159 62%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF YE E TSVIP  RLFK+F+LD DNLIPK+APQ     E +EG+GG GTIKK+TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGG-SIIKTTS 119
            EGS++ Y+K++V  ID  NF Y YS+IEG  L   LEKI+YE K+ A+P GG SI+K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
             YH KG+  I EE +KAGKEKA+GLFK +EAYLLAH D Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 92. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 168.5 bits 653,  Expect = 8e-44
 Identities = 94/160 58%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG  + +VK+RV+ +D  NF YSY++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 167.7 bits 650,  Expect = 1e-43
 Identities = 93/160 58%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI   E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 166.8 bits 646,  Expect = 3e-43
 Identities = 95/159 59%, Positives = 129/159 81%, Gaps = 1/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV+NYE++ TSVIP  RLFKAF+LD DNLI K+ P+A+KSTEIIEG+GG GTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E S+  Y K+R++ +D +N +YS+S+IEG+ L+D +  I+ E K++ASPDGGSI+K+T+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            Y+ KG  ++KEE+++A  EK +GLFK +EAYLLAH D YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 95. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 166.5 bits 645,  Expect = 3e-43
 Identities = 93/160 58%, Positives = 124/160 77%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 165.0 bits 639,  Expect = 9e-43
 Identities = 92/159 57%, Positives = 123/159 77%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E + G+GG GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            GS + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            HAKG  E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 97. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 164.0 bits 635,  Expect = 2e-42
 Identities = 92/160 57%, Positives = 122/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SVIPA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF +SY++IEGD L DKLEK++ E K++A+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 98. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 162.8 bits 630,  Expect = 4e-42
 Identities = 94/157 59%, Positives = 122/157 77%, Gaps = 0/157 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PK+ P+AIK  +I+EGDG  GTIK+VTFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS++  VKQRV+ IDKDN+TYSY++IEGD L++K+E I+Y  K++A PDGGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSD 157
            Y  KGD ++ EE +K GKEKA+ +FK LEAYLLA+ D
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 99. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 162.8 bits 630,  Expect = 4e-42
 Identities = 94/158 59%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG GTIKK+TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E S++ Y K+R++ +D +N TYS+S+IEGD L+  +E ++ E K +ASPDGGSI+K+T+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            Y+ KGD ++KEE+++A  EKA+GL+K +EAYL+AH D Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 100. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 162.3 bits 628,  Expect = 6e-42
 Identities = 94/158 59%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +E++ TSVIP  RLFKAF+LD DNLIPK+ PQAIKS E IEG+GG GTIKK+TFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E S++ Y K+R++ +D +N TYS+S+IEGD L+D +  ++ E K++ASPDGGSI K+T+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            Y+ KGD ++KEE+++A  EK +GL K +EAYLLAH D Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 101. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 161.8 bits 626,  Expect = 8e-42
 Identities = 90/159 56%, Positives = 121/159 76%, Gaps = 0/159 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVFNYE ET SVIPA RLFK+++LDGD LIPK+APQ I S E + G+GG GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
            G  + +VK+RV+ +D  NF Y+Y++IEGD L DKLEK+++E K++A+P GGSI+K +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            HAKG  E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 102. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 161.6 bits 625,  Expect = 1e-41
 Identities = 90/160 56%, Positives = 121/160 75%, Gaps = 0/160 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVFNYE ET SV+PA RLFK+++LD D LIPK+APQAI S E + G+GG GTIK +TF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS + +VK+RV+ +D  NF +SY++IEGD L DKLEK++ E  ++A+P GGSI+K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            +HAKGD E+  E +K  KE A  L++ +E+YLLAH+  YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 158.1 bits 611,  Expect = 1e-40
 Identities = 92/150 61%, Positives = 116/150 77%, Gaps = 0/150 0%
Query  4    FNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGS 63
            FNYETETTSVIPA RLFKAFILDGDNL PK+APQAI S + IEG+GG GTIKK+ F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHA 123
             + YVK RV+ +D  NF Y+YS+IEG  + D LEKI+ E K++A+PDGG I+K ++ YH 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDVEIKEEHVKAGKEKASGLFKLLEAYLL 153
            KG+ E+K E+VKA KE    L++ +E+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 152.9 bits 590,  Expect = 4e-39
 Identities = 89/156 57%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG   Y+ E  S I A ++FKAF+LDGD +IPK  P+AI   + +EGDGGVGTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EGS +  VK+R++G+DK+NFTYSYS+IEG  L D +E I+Y  K++A+PDGG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSD 157
            Y  K D ++ EE +KAGKE+ASG+FK +EAYLLA+ D
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 133.1 bits 510,  Expect = 4e-33
 Identities = 78/159 49%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + +KS EI+EGDGG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG    Y+K++++ ID  N+   YS+IEGD L DKLE I Y+ K+ A+ DGG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            YH KGD  + EE    GK KA  LFK +EAYLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 131.6 bits 504,  Expect = 1e-32
 Identities = 77/159 48%, Positives = 108/159 67%, Gaps = 0/159 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q +K+ E IEGDGGVG+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG    Y+K++++ ID  N+   YS+IEGD L +KLE ITY+ K+ A+ +GG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            YH KGD  + EE    G+E+   + K +EAYLLA+   Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 130.2 bits 498,  Expect = 3e-32
 Identities = 79/158 50%, Positives = 107/158 67%, Gaps = 2/158 1%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E E  S +    L+KA++ D DN+IPK A  + KS E +EG+GG GTIKK+TF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  +V +++  ID+ N+ YSYS++ G  L D  EKIT+++KL+A P+GGS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160
            Y  KGD E  ++ +K GK KA  LFK +EAYLLAH D YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 126.2 bits 482,  Expect = 4e-31
 Identities = 73/155 47%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E +TTS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            YH+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 124.5 bits 475,  Expect = 1e-30
 Identities = 72/154 46%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
            GVF +E +TTS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
              +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            H+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 123.7 bits 472,  Expect = 2e-30
 Identities = 71/154 46%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            M VF +E +TTS +    L+KA++ D D ++PK A  + KS EI+EG+GG GTIKK++F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  +V +++  ID+ N+ YSYS++ G  L D  EKI+ ++KL   P+GGS++K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            YH+KGD    E+ +KAGK K+  LFK++EAYLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 111. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 123.7 bits 472,  Expect = 2e-30
 Identities = 74/157 47%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGVF +E E TS +P  +L+ A + D D++ PKI    +KS EI+EG+GG GTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  ++ ++V  ID+ N+ Y+YS++ G  L    EKIT+ETKL+  P+GGSI K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159
            YH KGD +  EE +K GK K  GLF+ +E Y+LA+   Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 112. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 122.3 bits 466,  Expect = 6e-30
 Identities = 70/155 45%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV   E   TS +PA +LFKA+ LD D L+P++ P AIK  EI+EGDGGVGT+K VT+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            + S Y  +KQ+++ IDK+ FT+SYS+I+GD L   ++ I     ++ + DGG    +T+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            ++ KGD  + EE++K   ++ + +FK +EAYLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 119.9 bits 457,  Expect = 4e-29
 Identities = 69/146 47%, Positives = 98/146 67%, Gaps = 0/146 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  Y  E+T+ I   RLFKA++LD DNL+PK+  Q +K+ E IEGDGGVG+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            EG    Y+K++++ ID  N+   YS+IEGD L +KLE ITY+ K+ A+ +GG + KTT+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFK 146
            YH KGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 114. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 118.8 bits 452,  Expect = 7e-29
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV     E  S + A ++++ F+LD D + PK+ PQ IKS EI+EGDGGVGT+K V +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E ++Y  +KQ+V+ IDK  + Y+Y+ I GD L D LE +  E  ++   DGG I+K T+ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            Y+ KGD  + E+ +K   EK++  FK +EAYLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 117.8 bits 448,  Expect = 1e-28
 Identities = 70/153 45%, Positives = 104/153 67%, Gaps = 3/153 1%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV   E E  S + A ++++ F+LD D + PK+ PQ IKS EI+EGDGGVGT++ V +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP-DGGSIIKTTS 119
            E ++Y  +KQ+V+ IDK  + Y+Y+ I GD L + LE +    +++  P DGG I+K T+
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV--NQFVVVPTDGGCIVKNTT 118
Query  120  HYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
             Y+ KGD  + E+ VK   EK++  FK +EAYLLA+
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 117.8 bits 448,  Expect = 1e-28
 Identities = 71/154 46%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            M VF ++ + TS +    L+ A+  D DN+IPK A  + +S EI+EG+GG GTIKK++F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  +V +++  +D+ N+ YSYS++ G  L D  EKIT +TK+    DGGS+IK T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            YH KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 117.6 bits 447,  Expect = 2e-28
 Identities = 69/153 45%, Positives = 108/153 70%, Gaps = 2/153 1%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +E E+TS +P  +LFKA ++DGD L PK+ P AI+S EI+EG+GG GT+KKVT  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            E  +  YV ++++ ID+  +TY Y++  G  + + LEK++++TKL A+ DGGS IK +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            +H KGD  + +E  +  K+K+ G+FK +E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 118. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 114.8 bits 436,  Expect = 1e-27
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MGV  +  E TS + A ++F+ F++D D ++PK AP A KS EI +GDGG GT+K +T+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
            +G     +  R++G++K+ +T+ YS+I+GD L   +E I     L+ + DGGSI KTT+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            +H KGD  + EE++K   E+ + LFK LEAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 110.1 bits 417,  Expect = 3e-26
 Identities = 62/152 40%, Positives = 96/152 63%, Gaps = 0/152 0%
Query  7    ETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGSQYG 66
            E E TS +    +FKAF++D D + PK  P+  KS + IEGDGGVGTIK +T+ +G  + 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHAKGD 126
              K++V+ ID +NF+ SY++ EGD L   +E  T+  K++ S DGGS+ K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  VEIKEEHVKAGKEKASGLFKLLEAYLLAHSDA 158
             ++ +E+V   KE     FK +E Y+++H +A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 107.7 bits 407,  Expect = 2e-25
 Identities = 66/152 43%, Positives = 101/152 66%, Gaps = 5/152 3%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS ++ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP--DGGSIIKTT 118
            EGS    +  R + ++K+ +TY  ++I+GD L   +E I  ET L+  P  DGGSI KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            + +H KGD  + EE++K   E+ + LFK +EAYL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 106.9 bits 404,  Expect = 3e-25
 Identities = 66/152 43%, Positives = 100/152 65%, Gaps = 5/152 3%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS E+ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP--DGGSIIKTT 118
            EGS    +  R + ++K+ +TY  ++I+GD L   +E I  ET L+  P  DGGSI KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  119  SHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            + +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 106.2 bits 401,  Expect = 4e-25
 Identities = 64/152 42%, Positives = 101/152 66%, Gaps = 5/152 3%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS ++ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP--DGGSIIKTT 118
            EGS    +  R + ++K+ +TY  ++I+GD L + +E I  ET ++  P  DGGSI KTT
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  119  SHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            + +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 105.6 bits 399,  Expect = 7e-25
 Identities = 64/152 42%, Positives = 101/152 66%, Gaps = 5/152 3%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG  ++  E TS + A ++F   +LD D +IPK AP A KS ++ +GDGG GT++ +T+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP--DGGSIIKTT 118
            EGS    +  R + ++K+ +TY  ++I+GD L + +E I  ET ++  P  DGGSI KTT
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  119  SHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            + +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 103.0 bits 388,  Expect = 4e-24
 Identities = 63/152 41%, Positives = 99/152 65%, Gaps = 5/152 3%
Query  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
            MG  ++  E TS + A ++F   +LD D +IPK A  A KS E+ +GDGG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASP--DGGSIIKTT 118
            EGS    +  R + ++K+ ++Y  ++I+GD L   +E I  ET ++  P  DGGSI KTT
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  119  SHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155
            + +H KGD  + EE++K    + + LFK +EAYL+A+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 93.5 bits 348,  Expect = 2e-21
 Identities = 75/100 75%, Positives = 84/100 84%, Gaps = 39/100 39%
Query  22   AFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFT 81
            AF+LD DNLIPK                      K+TFGEGSQYGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHAKGDVEIKEEHVKAGKEKA 141
                 +EGD LSD LEKI YETKL+++P   +IIKTTS YH KGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  SGLFKLLEAYLLAHSDAYN 160
            + LFKL+E YL  H   YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 61.7 bits 217,  Expect = 4e-12
 Identities = 34/49 69%, Positives = 40/49 81%, Gaps = 0/49 0%
Query  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG 50
            GVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 53.8 bits 189,  Expect = 3e-09
 Identities = 44/144 30%, Positives = 68/144 47%, Gaps = 7/144 4%
Query  4    FNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGS 63
            FN +TE +  + A  L+  +  D   ++PK+ P+ +K  ++IEGDGGVGTI    F    
Sbjct  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
Query  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHA 123
               Y ++ +   D+ +      +IEG  L+  L       KL    +  +++     Y  
Sbjct  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
Query  124  KGDVEIKEEHVKAGKEKASGLFKL--LEAYL 152
              D+E   E V   K   S L  L  LE YL
Sbjct  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 35.3 bits 108,  Expect = 0.0001
 Identities = 16/24 66%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVFNYETETTSVIPAPRLFKAFIL 25
            GVF +E++ TSVIP  RLFKAF+L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.