The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA50327 Cor a 1.0101 160 1027 240.4 1.8e-65
Q08407 Cor a 1 159 1020 238.8 5.2e-65
CAA50328 Cor a 1.0102 160 1010 236.6 2.5e-64
CAA50325 Cor a 1.0103 160 1006 235.7 4.7e-64
CAA50326 Cor a 1.0104 160 984 230.7 1.5e-62
ABZ81040 Car b 1.0109 160 948 222.6 4.2e-60
ABZ81043 Car b 1.0112 160 944 221.6 7.9e-60
ABZ81041 Car b 1.0110 160 943 221.4 9.2e-60
ADK39021 Ost c 1.0101 160 943 221.4 9.2e-60
ABZ81044 Car b 1.0113 160 940 220.7 1.5e-59
ABZ81042 Car b 1.0111 160 939 220.5 1.7e-59
CAB02206 Car b 1.0103 160 932 218.9 5.2e-59
CAB02209 Car b 1.0106 160 932 218.9 5.2e-59
CAB02207 Car b 1.0104 160 931 218.7 6.1e-59
CAA47357 Car b 1.0102 159 926 217.6 1.3e-58
CAB02208 Car b 1.0105 160 920 216.2 3.4e-58
CAB02213 Car b 1.0107 160 918 215.8 4.7e-58
P38949 Car b 1 159 908 213.5 2.2e-57
CAB02215 Car b 1.0108 160 908 213.5 2.2e-57
P38950 Car b 1 159 888 209.0 5.1e-56
AAB24432 Aln g 1 160 814 192.2 5.7e-51
CAB02216 Car b 1.0301 161 813 192.0 6.7e-51
Q39427 Bet v 1.0205 160 810 191.3 1.1e-50
CAA96548 Cor a 1.0201 160 809 191.1 1.2e-50
CAB02217 Car b 1.0302 161 809 191.1 1.3e-50
P38948 Aln g 1 159 807 190.6 1.7e-50
P43186 Bet v 1.0204 160 806 190.4 2e-50
CAA54421 Bet v 1.0201 160 801 189.3 4.4e-50
P43184 Bet v 1.0203 160 799 188.8 6e-50
CAA04828.1 Bet v 1.0206 159 796 188.2 9.5e-50
CAA54481 Bet v 1.0202 160 790 186.8 2.4e-49
CAB02160 Bet v 1.0113 160 787 186.1 3.9e-49
CAB02159 Bet v 1.0112 160 782 185.0 8.6e-49
CAA54484 Bet v 1.0104 160 782 185.0 8.6e-49
CAA33887 Bet v 1.0101 160 782 185.0 8.6e-49
CAB02156 Bet v 1.0109 160 781 184.8 1e-48
CAB02161 Bet v 1.0114 160 780 184.5 1.2e-48
CAA54487 Bet v 1.0106 160 778 184.1 1.6e-48
CAA54482 Bet v 1.0102 160 774 183.2 3e-48
CAA54483 Bet v 1.0103 160 773 183.0 3.5e-48
CAA07329.1 Bet v 1.0118 160 770 182.3 5.6e-48
CAA54489 Bet v 1.0107 160 769 182.0 6.6e-48
CAA07323.1 Bet v 1.0117 160 769 182.0 6.6e-48
CAB02155 Bet v 1.0108 160 768 181.8 7.7e-48
CAB02157 Bet v 1.0110 160 767 181.6 9e-48
CAA04827.1 Bet v 1.0116 159 764 180.9 1.4e-47
CAA54485 Bet v 1.0105 160 763 180.7 1.7e-47
CAB02158 Bet v 1.0111 160 760 180.0 2.7e-47
CAA96547 Bet v 1.0115 160 760 180.0 2.7e-47
ACF75030.1 Bet v 1.0207 150 748 177.3 1.6e-46
ABC41615.1 Bet v 1.0119 150 711 169.0 5.3e-44
CAA54696.1 Bet v 1.0301 160 705 167.6 1.5e-43
CAA96549 Cor a 1.0301 160 696 165.5 6.2e-43
CAA96535 Mal d 1.0401 160 692 164.6 1.2e-42
APD76154 Jug r 5.0101 160 689 163.9 1.9e-42
CAA96536 Mal d 1.0402 160 679 161.7 8.9e-42
ACJ23864 Fag s 1.0101 160 677 161.2 1.2e-41
CAD10374 Cas s 1 160 676 161.0 1.4e-41
CAA96537 Mal d 1.0403 160 675 160.8 1.7e-41
AAD48405 Cor a 1.0401 161 666 158.7 6.9e-41
AAG40331 Cor a 1.0404 161 666 158.7 6.9e-41
AAG40329 Cor a 1.0402 161 662 157.8 1.3e-40
AAG40330 Cor a 1.0403 161 659 157.1 2.1e-40
ABZ81046 Que a 1.0301 160 639 152.6 4.7e-39
Q2I6V8 Pru p 1.0101 160 637 152.2 6.5e-39
O24248 Pru av 1 160 635 151.7 8.8e-39
AUH28179 Que m 1.0101 160 616 147.4 1.7e-37
Q256S7 Fra a 1 160 616 147.4 1.7e-37
Q3T923 Fra a 1 160 614 147.0 2.4e-37
CAA96534 Mal d 1.0301 159 612 146.5 3.2e-37
Q256S2 Fra a 1 160 610 146.1 4.5e-37
O50001 Pru ar 1 160 609 145.8 5.2e-37
Q256S6 Fra a 1 160 607 145.4 7.1e-37
AAK13027 Mal d 1.0302 159 604 144.7 1.1e-36
AAO25113 Mal d 1.0304 159 599 143.6 2.5e-36
Q256S4 Fra a 1 159 595 142.7 4.6e-36
ABZ81047 Que a 1.0401 160 591 141.8 8.8e-36
B6CQS9 Pru du 1.0101 160 591 141.8 8.8e-36
AAB01362 Mal d 1.0201 159 590 141.5 1e-35
AAD26545 Mal d 1.0202 159 590 141.5 1e-35
AAD13683 Mal d 1.0206 159 589 141.3 1.2e-35
AAK13028 Mal d 1.0303 159 587 140.9 1.6e-35
AAD26548 Mal d 1.0204 159 586 140.6 1.9e-35
AAD26547 Mal d 1.0203 159 584 140.2 2.6e-35
AAK13030 Mal d 1.0207 159 584 140.2 2.6e-35
AAD26546 Mal d 1.0103 159 584 140.2 2.6e-35
CAD32318 Mal d 1.0208 158 583 140.0 3e-35
AAD29671 Mal d 1.0108 159 582 139.7 3.6e-35
AAD26558 Mal d 1.0205 159 582 139.7 3.6e-35
AAD26552 Mal d 1.0104 159 580 139.3 4.9e-35
O65200 Pyr c 1 159 579 139.1 5.7e-35
AFN42528 Can s 5.0101 161 579 139.0 5.8e-35
CAA58646 Mal d 1.0101 159 578 138.8 6.7e-35
AAD26555 Mal d 1.0107 159 577 138.6 7.8e-35
AAD26553 Mal d 1.0105 159 576 138.4 9.2e-35
AAD26554 Mal d 1.0106 159 576 138.4 9.2e-35
AAK13029 Mal d 1.0109 159 572 137.5 1.7e-34
CAA88833 Mal d 1.0102 159 570 137.0 2.3e-34
QGS84240 Que i 1.0101 159 565 135.9 5.1e-34
CAM31908 Act c 8.0101 159 560 134.8 1.1e-33
ABZ81045 Que a 1.0201 159 557 134.1 1.8e-33
QOL10866 Que ac 1.0101 159 557 134.1 1.8e-33
CAM31909 Act d 8.0101 157 508 123.0 3.9e-30
Q0Z8U9 Rub i 1.0101 137 505 122.4 5e-30
CAA42646 Gly m 4 158 477 116.0 5e-28
NP_001275580 Sola l 4.0201 160 461 112.3 6.3e-27
AHC08073 Sola l 4.0101 160 451 110.1 3e-26
CAA43637 Pha v 1 156 446 109.0 6.4e-26
CAA43636 Pha v 1 155 442 108.1 1.2e-25
AAQ91847 Ara h 8.0101 157 442 108.1 1.2e-25
P25985 Pha v 1 155 439 107.4 1.9e-25
EF436550 Ara h 8.0201 153 427 104.7 1.2e-24
CAA75803 Lyc e 4.0101 178 409 100.5 2.6e-23
CAA67246 Pet c PR10 155 407 100.2 2.9e-23
P92918 Api g 1.0201 159 407 100.1 3e-23
Q2VU97 Vig r 1.0101 155 402 99.0 6.3e-23
AAB92255 Tar o RAP 157 402 99.0 6.4e-23
AAL76932 Dau c 1.0201 154 401 98.8 7.3e-23
P49372 Api g 1 154 381 94.3 1.7e-21
CAB03716 Dau c 1.0104 154 372 92.2 6.9e-21
CAB06416 Dau c 1.0105 154 369 91.6 1.1e-20
BAA13604 Dau c 1.0102 154 366 90.9 1.8e-20
AAB01092 Dau c 1.0101 168 364 90.4 2.7e-20
CAB03715 Dau c 1.0103 154 353 87.9 1.4e-19
Q5ULZ4 Fra a 1.0101 100 254 65.8 3.9e-13
P85126 Que a 1.0101 50 194 52.8 1.7e-09
Q9ZWP8 Vig r 6.0101 155 162 44.7 1.4e-06
Q9S8Q4 Cas s 1 24 97 31.3 0.0023
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 240.4 bits 1027,  Expect = 2e-65
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 2. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 238.8 bits 1020,  Expect = 5e-65
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 3. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 236.6 bits 1010,  Expect = 3e-64
 Identities = 158/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 4. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 235.7 bits 1006,  Expect = 5e-64
 Identities = 157/160 98%, Positives = 158/160 98%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEE+KGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 5. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 230.7 bits 984,  Expect = 1e-62
 Identities = 155/160 96%, Positives = 155/160 96%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYEVETPSVI AARLFKSYVLDGDKLIPKVAPQAITSVENV GNGGPGTIKNITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGSRYKYVKERVDEVDNTNF YSYTVIEGDVLGDKLEKVC ELKIVAAPGGGS LKISSK
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 6. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 222.6 bits 948,  Expect = 4e-60
 Identities = 146/160 91%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 7. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 221.6 bits 944,  Expect = 8e-60
 Identities = 145/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 8. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 221.4 bits 943,  Expect = 9e-60
 Identities = 144/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGS++KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 9. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 221.4 bits 943,  Expect = 9e-60
 Identities = 145/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+ VENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSILKISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 10. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 220.7 bits 940,  Expect = 1e-59
 Identities = 145/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +K+VKERVDEVDN NF YSYTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 11. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 220.5 bits 939,  Expect = 2e-59
 Identities = 144/160 90%, Positives = 153/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 12. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 218.9 bits 932,  Expect = 5e-59
 Identities = 143/160 89%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 13. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 218.9 bits 932,  Expect = 5e-59
 Identities = 144/160 90%, Positives = 152/160 95%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 14. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 218.7 bits 931,  Expect = 6e-59
 Identities = 143/160 89%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGD LEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 15. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 217.6 bits 926,  Expect = 1e-58
 Identities = 143/159 89%, Positives = 151/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQAI+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 16. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 216.2 bits 920,  Expect = 3e-58
 Identities = 142/160 88%, Positives = 151/160 94%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSK
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAE+MKGAKEMAEKLLRAVE+YLLAH+ EYN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 17. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 215.8 bits 918,  Expect = 5e-58
 Identities = 143/160 89%, Positives = 150/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  ELKIVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 18. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 213.5 bits 908,  Expect = 2e-57
 Identities = 140/159 88%, Positives = 149/159 93%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ETPSVIPAARLFKSYVLDGDKLIPKVAPQ I+SVENV GNGGPGTIKNITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            G  +K+VKERVDEVDN NF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAE+MKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 19. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 213.5 bits 908,  Expect = 2e-57
 Identities = 141/160 88%, Positives = 149/160 93%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSV+PAARLFKSYVLD DKLIPKVAPQAI+SVENV GNGGPGTIKNITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K+VKERVDEVDN NF +SYTVIEGDVLGDKLEKV  EL IVAAPGGGSILKIS K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FHAKGDHE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 20. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 209.0 bits 888,  Expect = 5e-56
 Identities = 135/159 84%, Positives = 150/159 94%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS  KYVKERV+E+D+TNF Y+YTVIEGDVLGDKLEKV HELKIVAAPGGGSI+KISSKF
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            HAKG HE+NAEEMKGAKEMAEKLLRAVE+YLLAH+AEYN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 21. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 192.2 bits 814,  Expect = 6e-51
 Identities = 122/160 76%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ETPSVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            FH KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 22. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 192.0 bits 813,  Expect = 7e-51
 Identities = 121/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDG+KLIPKV+PQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 23. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 191.3 bits 810,  Expect = 1e-50
 Identities = 121/160 75%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE AE LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 24. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 191.1 bits 809,  Expect = 1e-50
 Identities = 120/160 75%, Positives = 141/160 88%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E+ SVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKIS+K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE++AE +KG KE  E L+RAVE YLLAHS  YN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 25. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 191.1 bits 809,  Expect = 1e-50
 Identities = 121/160 75%, Positives = 140/160 87%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDG+ LIPKVAPQA++SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  KYVKERV+EVD+TNF YSYTVIEG  +GDK+EK+C+E+KIVAAP GGSILKI+SK
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE +KG KE  E LL+ VE YLLAH+AEYN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 26. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 190.6 bits 807,  Expect = 2e-50
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ETPSVIPAARLFK+++LDGDKL+PKVAP+A++SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +KYVKERVDEVD  NF YS++VIEG  +GD LEKVC+E+KIVAAP GGSILKIS+KF
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHEINAE++K  KE A  LL+AVE+YLLAHS  YN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 27. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 190.4 bits 806,  Expect = 2e-50
 Identities = 121/160 75%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 189.3 bits 801,  Expect = 4e-50
 Identities = 120/160 75%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 188.8 bits 799,  Expect = 6e-50
 Identities = 120/160 75%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 30. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 188.2 bits 796,  Expect = 9e-50
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+K+VA P GGSILKIS+K+
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 31. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 186.8 bits 790,  Expect = 2e-49
 Identities = 119/160 74%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD+E+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 32. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 186.1 bits 787,  Expect = 4e-49
 Identities = 116/160 72%, Positives = 139/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 185.0 bits 782,  Expect = 9e-49
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 185.0 bits 782,  Expect = 9e-49
 Identities = 115/160 71%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 185.0 bits 782,  Expect = 9e-49
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 36. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 184.8 bits 781,  Expect = 1e-48
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 184.5 bits 780,  Expect = 1e-48
 Identities = 116/160 72%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GGSILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 38. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 184.1 bits 778,  Expect = 2e-48
 Identities = 115/160 71%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 183.2 bits 774,  Expect = 3e-48
 Identities = 113/160 70%, Positives = 138/160 86%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE+ET SVIPAARLFK+++LDGD L+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 40. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 183.0 bits 773,  Expect = 4e-48
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK RVDEVD+TNF YSY+VIEG  +GD LEK+ +E+KIVA P GGSILKI++K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 41. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 182.3 bits 770,  Expect = 6e-48
 Identities = 115/160 71%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD LIPKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+K+VA P GGSIL+IS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE MK  KE  E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 42. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 182.0 bits 769,  Expect = 7e-48
 Identities = 112/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIPAAR+FK+++LDGDKL+PKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 43. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 182.0 bits 769,  Expect = 7e-48
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 44. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 181.8 bits 768,  Expect = 8e-48
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 45. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 181.6 bits 767,  Expect = 9e-48
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 46. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 180.9 bits 764,  Expect = 1e-47
 Identities = 113/159 71%, Positives = 135/159 84%, Gaps = 0/159 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVFNYE E  SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            G  +KYVK+RVDEVD+ NF YSY++IEG  +GD LEK+ +E+KIVA P GGSILKIS+K+
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 180.7 bits 763,  Expect = 2e-47
 Identities = 113/160 70%, Positives = 137/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK I F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 180.0 bits 760,  Expect = 3e-47
 Identities = 112/160 70%, Positives = 136/160 85%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
             G  +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG +LKIS+K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+HE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 180.0 bits 760,  Expect = 3e-47
 Identities = 114/160 71%, Positives = 135/160 84%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SVEN+EGNGGPGTIK I+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG  +KYVK+RVDEV + NF YSY+VIEG  +GD LEK+ +E+KIVA P G SILKIS+K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHE+ AE++K +KEM E LLRAVE+YLLAHS  YN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 177.3 bits 748,  Expect = 2e-46
 Identities = 112/150 74%, Positives = 129/150 86%, Gaps = 0/150 0%
Query  4    FNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 63
            FNYE ET SVIPAARLFK+++L+GD LIPKVAPQAI+SVEN+EGNGGPGTIK ITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 123
             +KYVKERVDEVD+ NF YSY++IEG  LGD LEK+C+E+KIVA P GGSILKIS+K+H 
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 153
            KGDHE+ AE MK  KE  E LLRAVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 51. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 169.0 bits 711,  Expect = 5e-44
 Identities = 105/150 70%, Positives = 128/150 85%, Gaps = 0/150 0%
Query  4    FNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGS 63
            FNYE ET SVIPAARLFK+++LDGD L PKVAPQAI+SV+N+EGNGGPGTIK I F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   RYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHA 123
             +KYVK+RVDEVD+TNF Y+Y+VIEG  +GD LEK+ +E+KIVA P GG ILKIS+K+H 
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  124  KGDHEINAEEMKGAKEMAEKLLRAVETYLL 153
            KG+HE+ AE++K +KEM E LLRAVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 52. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 167.6 bits 705,  Expect = 2e-43
 Identities = 105/160 65%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVI  ARLFKS+VLD D LIPKVAP+ ++S EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +KY+K RVDE+D+ NF Y Y++IEG  LGD LEK+ +E+KIVAAPGGGSILKI+SK
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD  +N EE+K  KE    L++AVE YL+AH   YN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 53. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 165.5 bits 696,  Expect = 6e-43
 Identities = 104/160 65%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIP ARLFK +VLD D LIPKVAP+AI S+E +EGNGGPGTIK I F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS + Y+K++V+E+D  NF+Y Y+VIEGD L DKLEK+ +E+KIVA+P GGSILK  SK
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H  GDHE+  E++K  KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 164.6 bits 692,  Expect = 1e-42
 Identities = 102/160 63%, Positives = 127/160 79%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE ET SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 163.9 bits 689,  Expect = 2e-42
 Identities = 104/160 65%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E+ SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK I FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+YKYVK R D +D  NFTY+Y+VIEGD L DK+EK+ +E KIVA+  GGSILK  S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H+KGDHEI  E++K  KE A  L++AVE YLLAH   YN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 56. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 161.7 bits 679,  Expect = 9e-42
 Identities = 100/160 62%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S + +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +HAKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 161.2 bits 677,  Expect = 1e-41
 Identities = 100/160 62%, Positives = 128/160 80%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE ET +VI  ARLFK++VLD D LIPKVAPQAI S E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS++ YVK R+DE+DN NFTY+ T+IEGD + + LEK+ +E+K+VA+P GGSILK +SK
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGDHEI  +++K  KE A  +++AVE YLLA+ A Y+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 58. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 161.0 bits 676,  Expect = 1e-41
 Identities = 101/160 63%, Positives = 126/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E  S IP  RLFK++VLD D LIPK+AP+AI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS++KYVK R+DE+D  NFTY Y+VIEGDV+ + LEK+ +E+KIVA+P GGSILK +SK
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG++EI  E++   KE A  L++AVE YLLAHS  YN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 160.8 bits 675,  Expect = 2e-41
 Identities = 100/160 62%, Positives = 125/160 78%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIPA RLFK+++LDGD LIPK+APQAI S E +EG+GG GTIK +TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK+RV+ +D  NFTYSY++IEGD L DKLEK+ +E K++A+P GGSI+K +S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            + AKGD EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 158.7 bits 666,  Expect = 7e-41
 Identities = 102/159 64%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EG+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 61. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 158.7 bits 666,  Expect = 7e-41
 Identities = 102/159 64%, Positives = 124/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  TS EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EG+ +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  IN EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 62. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 157.8 bits 662,  Expect = 1e-40
 Identities = 101/159 63%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF+YE E  SVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EGS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 63. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 157.1 bits 659,  Expect = 2e-40
 Identities = 101/159 63%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARLFKS+VLD D LIPKVAPQ  T  EN+EGNGGPGTIK ITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAP-GGGSILKISS 119
            EGS +KY+K +V+E+D+ NF Y Y++IEG  LG  LEK+ +E+K+ AAP GGGSILKI+S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            K+H KG+  I+ EE+K  KE A  L++AVE YLLAH   Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 64. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 152.6 bits 639,  Expect = 5e-39
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI+K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A ++++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 65. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 152.2 bits 637,  Expect = 6e-39
 Identities = 94/160 58%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D +D  N +YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 66. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 151.7 bits 635,  Expect = 9e-39
 Identities = 93/160 58%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  S IP  RLFK++VLD D L+PK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D +D  N++YSYT+IEGD LGD LEK+ +E K+VA+P GGSI+K +S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +ETYL  H   YN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 67. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 147.4 bits 616,  Expect = 2e-37
 Identities = 94/159 59%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  YE E  SVIP ARLFK++VLD D LIPKV PQA+ S E +EGNGGPGTIK ITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFT+S++VIEGD L DKLE V  E KIVA+P GGSI+K + K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 68. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 147.4 bits 616,  Expect = 2e-37
 Identities = 91/160 56%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 69. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 147.0 bits 614,  Expect = 2e-37
 Identities = 89/160 55%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+++K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 70. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 146.5 bits 612,  Expect = 3e-37
 Identities = 92/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVFNYE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H K D EI  E +K  KE A  L++ +E YLLAHS  YN
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 71. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 146.1 bits 610,  Expect = 4e-37
 Identities = 89/160 55%, Positives = 117/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L + +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 72. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 145.8 bits 609,  Expect = 5e-37
 Identities = 90/160 56%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP  +LFK+++LD D LIPKVAP A+   E +EG+GG GTIK +TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK RVD +D  N++YSYT+IEGD L D +E + +++K+VA+P GGSI+K +S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ VE YLLA+   YN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 73. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 145.4 bits 607,  Expect = 7e-37
 Identities = 90/160 56%, Positives = 116/160 72%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG + YE E  S IPA +LFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP GG+I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 74. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 144.7 bits 604,  Expect = 1e-36
 Identities = 91/159 57%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VAA G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 75. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 143.6 bits 599,  Expect = 2e-36
 Identities = 90/159 56%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 76. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 142.7 bits 595,  Expect = 5e-36
 Identities = 89/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ YE E  S IPA +LFK++VLD D LIPK+APQA+   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++  +D  N TYSY++IEGD L D +EK+ +E K+V+AP G +I+K +SK
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 77. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 141.8 bits 591,  Expect = 9e-36
 Identities = 93/159 58%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS  K+ K R+D +D  NFTYS++VIEGD L DKLE V  E KIVA+P GGSI K +SK
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E ++G KE A  +++AVE YL+AH   Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 78. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 141.8 bits 591,  Expect = 9e-36
 Identities = 85/160 53%, Positives = 118/160 73%, Gaps = 0/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG+F Y  E+ SVIP  RLFK+ VL+ D LIPK+APQ++ S E VEG+GG GTIK I+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++D +D  NF Y+Y+++EGD L DK+EK+ +E+K+VA+  GGS++K +S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E++K  KE A  L++ +E YL+A+   YN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 79. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 141.5 bits 590,  Expect = 1e-35
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 80. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 141.5 bits 590,  Expect = 1e-35
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 81. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 141.3 bits 589,  Expect = 1e-35
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK +VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 82. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 140.9 bits 587,  Expect = 2e-35
 Identities = 88/159 55%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  SVIP ARL+ ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS Y YVK ++D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K  S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 83. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 140.6 bits 586,  Expect = 2e-35
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K++A+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 84. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 140.2 bits 584,  Expect = 3e-35
 Identities = 89/159 55%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E++L  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 85. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 140.2 bits 584,  Expect = 3e-35
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGT K ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 86. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 140.2 bits 584,  Expect = 3e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 87. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 140.0 bits 583,  Expect = 3e-35
 Identities = 90/158 56%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GV+ YE E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
            GS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S +
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 88. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 139.7 bits 582,  Expect = 4e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 89. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 139.7 bits 582,  Expect = 4e-35
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EG+GGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK ++D VD  N++Y+YT+IEGD L D +EKV +E K+VA+ G GSI+K  S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +   KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 90. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 139.3 bits 580,  Expect = 5e-35
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 91. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 139.1 bits 579,  Expect = 6e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG++ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK RVD +D  +++Y+YT+IEGD L D +EK+ +E K+VA+ G GS +K  S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVAS-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KGD EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 92. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 139.0 bits 579,  Expect = 6e-35
 Identities = 84/160 52%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF YE E  S I  ARLFK++VLDGD L+PK+APQA+  VE +EGNGG GTIK ITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVL-GDKLEKVCHELKIVAAPGGGSILKISS 119
            +G  +KYVK +++ +D  ++TYSY++IEGD L G++LEK+ HE K+VA+  GG+++K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  KFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            K+++ GD ++N E++K  ++ A ++L+ VE YL  H   YN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 93. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 138.8 bits 578,  Expect = 7e-35
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 94. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 138.6 bits 577,  Expect = 8e-35
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  K  A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 95. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 138.4 bits 576,  Expect = 9e-35
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 96. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 138.4 bits 576,  Expect = 9e-35
 Identities = 87/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +E + +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 97. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 137.5 bits 572,  Expect = 2e-34
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 98. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 137.0 bits 570,  Expect = 2e-34
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+ +E E  S IP +RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G G+ +K  S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGATIKSISH 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +H KG+ EI  E +K  KE    L++ +E+YL  H   YN
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 99. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 135.9 bits 565,  Expect = 5e-34
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E +  SVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 100. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 134.8 bits 560,  Expect = 1e-33
 Identities = 82/155 52%, Positives = 117/155 75%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y++E PS +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +  KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155

Sequence Alignment: 101. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 134.1 bits 557,  Expect = 2e-33
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGPGTIK ITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S++KY K R+D +D  N TYS++VIEGD L   +E V  E+K VA+P GGSI+K ++K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            ++ KGD ++  E+++ A E A  LL+AVE YL+AH   Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 102. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 134.1 bits 557,  Expect = 2e-33
 Identities = 84/159 52%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV+NYE +  SVIP ARLFK++VLD D LI KV P+A+ S E +EGNGGPGTIK  TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E S+ KY K R+D +D  N +YS++VIEG+ L D +  +  E+K VA+P GGSI+K ++K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            ++ KG  ++  E+++ A E    L++AVE YLLAH   YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 103. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 123.0 bits 508,  Expect = 4e-30
 Identities = 79/154 51%, Positives = 108/154 70%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG   Y++E PS I A ++FK++VLDGD +IPK  P+AIT V+ +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS +K VK R+D +D  NFTYSY++IEG  L D +E + + +KIVA P GG I K  S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +  K D +++ EE+K  KE A  +++ VE YLLA+
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLAN 154

Sequence Alignment: 104. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 122.4 bits 505,  Expect = 5e-30
 Identities = 73/134 54%, Positives = 102/134 76%, Gaps = 1/134 0%
Query  12   SVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKER 71
            SVIP  +LFK++VLD D LIPK+APQA+ SVE +EG+GG GT+K I +GEG+ + YVK +
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINA 131
            +D +D  NF YSY++ EGD LGDK+EK+ +E+K+VA+ G GSI+K +S +H KG  EI  
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EEMKGAKEMAEKLLR 146
            E++K  KE A  L++
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 105. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 116.0 bits 477,  Expect = 5e-28
 Identities = 77/158 48%, Positives = 104/158 65%, Gaps = 2/158 1%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E  S +  A L+K+ V D D +IPK A  +  SVENVEGNGGPGTIK ITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ +D  N+ YSY+V+ G  L D  EK+  + K+VA P GGS  K++ K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +  KGD E N +E+K  K  A+ L++A+E YLLAH  +YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP-DYN 158

Sequence Alignment: 106. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 112.3 bits 461,  Expect = 6e-27
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 110.1 bits 451,  Expect = 3e-26
 Identities = 65/159 40%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGDH ++ EE    +E    + +AVE YLLA+ + Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 109.0 bits 446,  Expect = 6e-26
 Identities = 66/155 42%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 155

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 108.1 bits 442,  Expect = 1e-25
 Identities = 67/154 43%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            M VF +E +T S +  A L+K+ V D D ++PK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++E+D  N+ YSY+++ G  L D  EK+  + K+   P GGS++K+S K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H+KGD   N +E+K  K  ++ L++ +E YLLA+
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLAN 154

Sequence Alignment: 110. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 108.1 bits 442,  Expect = 1e-25
 Identities = 68/157 43%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.4 bits 439,  Expect = 2e-25
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154

Sequence Alignment: 112. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 104.7 bits 427,  Expect = 1e-24
 Identities = 67/153 43%, Positives = 101/153 66%, Gaps = 2/153 1%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  +E E+ S +P A+LFK+ V+DGD+L PK+ P AI S+E VEGNGGPGT+K +T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E  +  YV  ++D +D   +TY YT+  G  + + LEKV  + K+ AA GG  I K+S  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKI-KVSVT 118
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E  +  K+ ++ +++A+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 113. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 100.5 bits 409,  Expect = 3e-23
 Identities = 59/142 41%, Positives = 92/142 64%, Gaps = 1/142 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  Y  E+ + I   RLFK+ VLD D L+PK+  Q + + E +EG+GG G+IK + F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EG   KY+K ++  +D+ N+   Y++IEGD+LG+KLE + +++K  A   GG + K +++
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  FHAKGDHEINAEEMK-GAKEMAE 142
            +H KGDH ++ EE   G +E  E
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHE 143

Sequence Alignment: 114. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 100.2 bits 407,  Expect = 3e-23
 Identities = 63/155 40%, Positives = 98/155 63%, Gaps = 0/155 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV   EV   S +PAA+LFK+  LD D L+P+V P AI   E +EG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            + S YK +K+++D +D   FT+SY++I+GD+L   ++ + + L  V    GG     ++ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            F+ KGD  +  E +K A +    +++AVE YLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 100.1 bits 407,  Expect = 3e-23
 Identities = 64/154 41%, Positives = 101/154 65%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV    VE PS + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L D LE V +E+ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 99.0 bits 402,  Expect = 6e-23
 Identities = 64/154 41%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            M VF ++ +  S +  A L+ +   D D +IPK A  +  SVE VEGNGGPGTIK I+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E    K+V  +++ VD  N+ YSY+++ G  L D  EK+  + KI     GGS++K++  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            +H KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 99.0 bits 402,  Expect = 6e-23
 Identities = 62/153 40%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            M V  +E+ T S+ P+  +FK++V+D D + PK  P+   S++ +EG+GG GTIK+IT+ 
Sbjct  1    MAVAEFEI-TSSLSPSN-IFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            +G  +   K +VD +D+ NF+ SYT+ EGDVL   +E   H LK + +  GGS+ K S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            F  KGD ++  E +   KE  +K ++A+ETY+++H
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISH 153

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 98.8 bits 401,  Expect = 7e-23
 Identities = 62/154 40%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV   EVE PS + A ++++ ++LD D + PKV PQ I SVE +EG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            E + Y  +K++VD +D   + Y+YT I GD+L + LE V +++ +V    GG I+K ++ 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            ++ KGD  +  +++K A E +   ++AVE YLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 94.3 bits 381,  Expect = 2e-21
 Identities = 60/154 38%, Positives = 98/154 63%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MGV  + +E  S + A ++F+ +V+D D ++PK AP A  SVE ++G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            +G     +  R+D V+   +T+ Y+VI+GD+L   +E + + + +V    GGSI K ++ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 92.2 bits 372,  Expect = 7e-21
 Identities = 63/154 40%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A E    L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 91.6 bits 369,  Expect = 1e-20
 Identities = 63/154 40%, Positives = 92/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L   +E +   L +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 90.9 bits 366,  Expect = 2e-20
 Identities = 61/154 39%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 90.4 bits 364,  Expect = 3e-20
 Identities = 61/154 39%, Positives = 93/154 60%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++ +E  S + A ++F   VLD D +IPK AP A  SV+ V+G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   +TY  TVI+GD+L + +E +   + +V    GGSI K ++ 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 87.9 bits 353,  Expect = 1e-19
 Identities = 60/154 38%, Positives = 91/154 59%, Gaps = 1/154 0%
Query  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
            MG  ++ +E  S + A ++F   VLD D +IPK A  A  SVE V+G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
            EGS    +  R D V+   ++Y  TVI+GD+L   +E +   + +V    GGSI K ++ 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155
            FH KGD  +  E +K A      L++A+E YL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 65.8 bits 254,  Expect = 4e-13
 Identities = 48/89 53%, Positives = 63/89 70%, Gaps = 17/89 19%
Query  55   KNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSI 114
            K ITFGEGS+Y YVK                 +EGD L D LEK+ +E K+V+AP   +I
Sbjct  12   KKITFGEGSQYGYVK-----------------VEGDALSDTLEKIDYETKLVSAPSSSTI 54
Query  115  LKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160
            +K +SK+H KGD EI  E +K  KE A  L++ +E YL  H +EYN
Sbjct  55   IKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 52.8 bits 194,  Expect = 2e-09
 Identities = 31/50 62%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 51
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 44.7 bits 162,  Expect = 1e-06
 Identities = 42/146 28%, Positives = 70/146 47%, Gaps = 13/146 8%
Query  4    FNYEVETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
            FN + E    + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
Query  122  HAKGDHEINAEEMKGAKEMAEKLL---RAVETYLLAHSA 157
                DH+ + EE     + ++  L   R +E YL   SA
Sbjct  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 31.3 bits 97,  Expect = 0.002
 Identities = 15/24 62%, Positives = 19/24 79%, Gaps = 0/24 0%
Query  2    GVFNYEVETPSVIPAARLFKSYVL 25
            GVF +E +  SVIP ARLFK++VL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.