The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVED
GETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYH
TKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAQ91847 Ara h 8.0101 157 1008 257.0 1.7e-70
CAA42646 Gly m 4 158 735 189.3 4.3e-50
CAA43637 Pha v 1 156 729 187.8 1.2e-49
CAA43636 Pha v 1 155 722 186.0 3.9e-49
P25985 Pha v 1 155 722 186.0 3.9e-49
Q2VU97 Vig r 1.0101 155 702 181.1 1.2e-47
EF436550 Ara h 8.0201 153 561 146.1 4.1e-37
CAA54696.1 Bet v 1.0301 160 554 144.3 1.5e-36
APD76154 Jug r 5.0101 160 551 143.6 2.4e-36
AAD48405 Cor a 1.0401 161 545 142.1 6.9e-36
AAG40331 Cor a 1.0404 161 545 142.1 6.9e-36
AAG40329 Cor a 1.0402 161 541 141.1 1.4e-35
AAG40330 Cor a 1.0403 161 538 140.4 2.3e-35
CAD10374 Cas s 1 160 525 137.1 2.1e-34
ACJ23864 Fag s 1.0101 160 519 135.6 6e-34
Q256S2 Fra a 1 160 515 134.7 1.2e-33
CAA96549 Cor a 1.0301 160 514 134.4 1.4e-33
Q3T923 Fra a 1 160 513 134.2 1.7e-33
O24248 Pru av 1 160 513 134.2 1.7e-33
Q256S7 Fra a 1 160 513 134.2 1.7e-33
B6CQS9 Pru du 1.0101 160 510 133.4 2.8e-33
Q2I6V8 Pru p 1.0101 160 508 132.9 4e-33
AAD26555 Mal d 1.0107 159 506 132.4 5.6e-33
O50001 Pru ar 1 160 506 132.4 5.6e-33
AAB01362 Mal d 1.0201 159 504 131.9 7.8e-33
AAD26545 Mal d 1.0202 159 504 131.9 7.8e-33
Q256S6 Fra a 1 160 504 131.9 7.9e-33
AAD26546 Mal d 1.0103 159 501 131.2 1.3e-32
CAA88833 Mal d 1.0102 159 501 131.2 1.3e-32
AAD26548 Mal d 1.0204 159 500 130.9 1.6e-32
AAD29671 Mal d 1.0108 159 499 130.7 1.9e-32
AAD13683 Mal d 1.0206 159 499 130.7 1.9e-32
AAK13030 Mal d 1.0207 159 498 130.4 2.2e-32
AAD26547 Mal d 1.0203 159 498 130.4 2.2e-32
CAA58646 Mal d 1.0101 159 497 130.2 2.6e-32
AAD26558 Mal d 1.0205 159 496 129.9 3.1e-32
AAD26552 Mal d 1.0104 159 496 129.9 3.1e-32
O65200 Pyr c 1 159 495 129.7 3.7e-32
Q256S4 Fra a 1 159 494 129.4 4.4e-32
AAD26554 Mal d 1.0106 159 493 129.2 5.2e-32
AAD26553 Mal d 1.0105 159 493 129.2 5.2e-32
CAA96548 Cor a 1.0201 160 492 128.9 6.2e-32
AAK13029 Mal d 1.0109 159 491 128.7 7.3e-32
CAD32318 Mal d 1.0208 158 488 128.0 1.2e-31
AAO25113 Mal d 1.0304 159 488 128.0 1.2e-31
P43186 Bet v 1.0204 160 488 128.0 1.2e-31
CAA54481 Bet v 1.0202 160 484 127.0 2.5e-31
P43184 Bet v 1.0203 160 483 126.7 2.9e-31
CAA04828.1 Bet v 1.0206 159 482 126.5 3.5e-31
ABZ81046 Que a 1.0301 160 482 126.5 3.5e-31
CAA54421 Bet v 1.0201 160 482 126.5 3.5e-31
Q39427 Bet v 1.0205 160 482 126.5 3.5e-31
AAK13027 Mal d 1.0302 159 476 125.0 9.7e-31
CAA07329.1 Bet v 1.0118 160 476 125.0 9.8e-31
AUH28179 Que m 1.0101 160 476 125.0 9.8e-31
CAB02160 Bet v 1.0113 160 474 124.5 1.4e-30
ABZ81047 Que a 1.0401 160 474 124.5 1.4e-30
CAB02217 Car b 1.0302 161 474 124.5 1.4e-30
CAA96535 Mal d 1.0401 160 472 124.0 1.9e-30
AAK13028 Mal d 1.0303 159 471 123.7 2.3e-30
CAA33887 Bet v 1.0101 160 471 123.7 2.3e-30
CAB02159 Bet v 1.0112 160 471 123.7 2.3e-30
CAB02156 Bet v 1.0109 160 470 123.5 2.7e-30
CAA96534 Mal d 1.0301 159 469 123.2 3.2e-30
CAB02216 Car b 1.0301 161 469 123.2 3.3e-30
CAA54487 Bet v 1.0106 160 468 123.0 3.9e-30
CAA54483 Bet v 1.0103 160 467 122.7 4.6e-30
QOL10866 Que ac 1.0101 159 465 122.3 6.4e-30
CAA54484 Bet v 1.0104 160 465 122.2 6.5e-30
CAA96537 Mal d 1.0403 160 463 121.8 9.2e-30
CAA96536 Mal d 1.0402 160 463 121.8 9.2e-30
CAB02161 Bet v 1.0114 160 460 121.0 1.5e-29
CAA04827.1 Bet v 1.0116 159 458 120.5 2.1e-29
ABZ81040 Car b 1.0109 160 458 120.5 2.2e-29
ABZ81043 Car b 1.0112 160 458 120.5 2.2e-29
CAA07323.1 Bet v 1.0117 160 458 120.5 2.2e-29
CAB02207 Car b 1.0104 160 458 120.5 2.2e-29
ABZ81041 Car b 1.0110 160 457 120.3 2.6e-29
CAB02155 Bet v 1.0108 160 457 120.3 2.6e-29
P38950 Car b 1 159 455 119.8 3.6e-29
CAB02209 Car b 1.0106 160 455 119.8 3.6e-29
AAB24432 Aln g 1 160 455 119.8 3.6e-29
CAA54489 Bet v 1.0107 160 454 119.5 4.3e-29
CAA54482 Bet v 1.0102 160 454 119.5 4.3e-29
ABZ81042 Car b 1.0111 160 453 119.3 5.1e-29
ADK39021 Ost c 1.0101 160 453 119.3 5.1e-29
CAB02157 Bet v 1.0110 160 452 119.0 6.1e-29
CAB02206 Car b 1.0103 160 452 119.0 6.1e-29
ACF75030.1 Bet v 1.0207 150 451 118.8 6.6e-29
CAA54485 Bet v 1.0105 160 451 118.8 7.2e-29
CAA50325 Cor a 1.0103 160 449 118.3 1e-28
CAB02158 Bet v 1.0111 160 449 118.3 1e-28
CAB02208 Car b 1.0105 160 449 118.3 1e-28
P38948 Aln g 1 159 448 118.0 1.2e-28
NP_001275580 Sola l 4.0201 160 448 118.0 1.2e-28
ABZ81044 Car b 1.0113 160 448 118.0 1.2e-28
CAB02213 Car b 1.0107 160 446 117.5 1.7e-28
CAA96547 Bet v 1.0115 160 444 117.0 2.4e-28
ABZ81045 Que a 1.0201 159 443 116.8 2.8e-28
CAA50327 Cor a 1.0101 160 442 116.5 3.4e-28
CAA47357 Car b 1.0102 159 440 116.0 4.7e-28
CAA50328 Cor a 1.0102 160 439 115.8 5.7e-28
QGS84240 Que i 1.0101 159 436 115.1 9.4e-28
CAB02215 Car b 1.0108 160 436 115.0 9.5e-28
AFN42528 Can s 5.0101 161 436 115.0 9.6e-28
Q08407 Cor a 1 159 435 114.8 1.1e-27
P38949 Car b 1 159 432 114.1 1.9e-27
CAM31908 Act c 8.0101 159 427 112.8 4.4e-27
ABC41615.1 Bet v 1.0119 150 421 111.4 1.1e-26
CAA50326 Cor a 1.0104 160 413 109.3 5e-26
AHC08073 Sola l 4.0101 160 400 106.1 4.7e-25
Q0Z8U9 Rub i 1.0101 137 389 103.5 2.5e-24
CAM31909 Act d 8.0101 157 374 99.7 4e-23
CAA75803 Lyc e 4.0101 178 348 93.1 4.2e-21
P92918 Api g 1.0201 159 322 86.8 3.1e-19
P49372 Api g 1 154 319 86.0 5e-19
AAL76932 Dau c 1.0201 154 316 85.3 8.3e-19
CAA67246 Pet c PR10 155 314 84.8 1.2e-18
AAB92255 Tar o RAP 157 295 80.1 3.2e-17
CAB03715 Dau c 1.0103 154 294 79.8 3.7e-17
CAB06416 Dau c 1.0105 154 293 79.6 4.3e-17
BAA13604 Dau c 1.0102 154 289 78.6 8.6e-17
AAB01092 Dau c 1.0101 168 286 77.8 1.6e-16
CAB03716 Dau c 1.0104 154 283 77.1 2.4e-16
Q5ULZ4 Fra a 1.0101 100 237 66.0 3.6e-13
P85126 Que a 1.0101 50 156 46.3 1.5e-07
Q9ZWP8 Vig r 6.0101 155 123 37.4 0.00022
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 257.0 bits 1008,  Expect = 2e-70
 Identities = 157/157 100%, Positives = 157/157 100%, Gaps = 0/157 0%
Query  1    MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVED 60
            MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVED
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVED 60
Query  61   GETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYH 120
            GETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYH
Sbjct  61   GETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYH 120
Query  121  TKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            TKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Sbjct  121  TKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 2. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 189.3 bits 735,  Expect = 4e-50
 Identities = 111/154 72%, Positives = 131/154 85%, Gaps = 1/154 0%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVE 59
            MGVFTFEDEI S V PA LY A+  DAD++ PK +D  KSVE VEGNGGPGTIKK+T +E
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
            DGETKF+LHK+ESIDEAN  Y+YSVVGG ALP TAEKITF++KLV GPNGGS GKLT+KY
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
             TKGDA+P+++ELK GKAK + LF+AIE Y+LA+P
Sbjct  121  ETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 3. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 187.8 bits 729,  Expect = 1e-49
 Identities = 110/154 71%, Positives = 133/154 86%, Gaps = 2/154 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIV 58
            MGVFTFED+ TS V PA LY A+ KDAD+I PK + D  KSVEIVEGNGGPGTIKK++ V
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            EDGETKF+LHK+ESIDEAN  Y+YS+VGGVALP TAEKITF++KL +GPNGGS+ KL++ 
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            YH+KGDA P+E+ELK GKAK + LF+A+E Y+LANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 4. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 186.0 bits 722,  Expect = 4e-49
 Identities = 106/154 68%, Positives = 129/154 83%, Gaps = 1/154 0%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVE 59
            M VFTFED+ TS V PA LY A+ KDAD+I PK +D  KSVEIVEGNGGPGTIKK++ VE
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
            DGETKF+LHK+E IDEAN  Y+YS+VGG ALP TAEKI+ ++KL +GPNGGS+ KL++KY
Sbjct  61   DGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            H+KGDA P+E+ELK GKAK + LF+ IE Y+LANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 5. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 186.0 bits 722,  Expect = 4e-49
 Identities = 109/153 71%, Positives = 132/153 86%, Gaps = 2/153 1%
Query  2    GVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIVE 59
            GVFTFED+ TS V PA LY A+ KDAD+I PK + D  KSVEIVEGNGGPGTIKK++ VE
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
            DGETKF+LHK+ESIDEAN  Y+YS+VGGVALP TAEKITF++KL +GPNGGS+ KL++ Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            H+KGDA P+E+ELK GKAK + LF+A+E Y+LANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 6. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 181.1 bits 702,  Expect = 1e-47
 Identities = 104/154 67%, Positives = 129/154 83%, Gaps = 1/154 0%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVE 59
            M VFTF+D+ TS V PA LYNA+ KDAD+I PK +   +SVEIVEGNGGPGTIKK++ VE
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVGSFQSVEIVEGNGGPGTIKKISFVE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
            DGETKF+LHK+ES+DEAN  Y+YS+VGGVALP TAEKIT +TK+ +G +GGS+ KLT+ Y
Sbjct  61   DGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            H KGDA P+E+ELK GKAK + LF+A+E Y+LANP
Sbjct  121  HGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 7. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 146.1 bits 561,  Expect = 4e-37
 Identities = 84/152 55%, Positives = 118/152 77%, Gaps = 2/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVE 59
            MGV TFE+E TS VPPAKL+ A + D D +TPK+I  ++S+EIVEGNGGPGT+KK+T VE
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
            DG+T ++LHK+++IDEA Y Y+Y++ GG  +    EK++F+TKL E  +GGS  K+++ +
Sbjct  61   DGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKL-EAADGGSKIKVSVTF 119
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            HTKGDA   +E  +  K K +G+F+AIEGYVL+N
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 8. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 144.3 bits 554,  Expect = 1e-36
 Identities = 83/157 52%, Positives = 114/157 72%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +EDE TS + PA+L+ + + DAD++ PK+  ++V S E +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++ H+V+ ID AN+ Y YS++ G  L  T EKI++E K+V  P GGSI K+T K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD   +EEE+K GK KG GLF+A+E Y++A+P  Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 9. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 143.6 bits 551,  Expect = 2e-36
 Identities = 84/157 53%, Positives = 114/157 72%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PPA+L+ A + DAD++ PK++   VKS EI+EGNGGPGTIKK+   
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  + K++ H+ ++IDEAN+ Y YSV+ G AL    EKI++ETK+V    GGSI K    
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YH+KGD +  EE++K GK K  GLF+A+EGY+LA+P  Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 10. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 142.1 bits 545,  Expect = 7e-36
 Identities = 85/157 54%, Positives = 113/157 71%, Gaps = 3/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +EDE TS +PPA+L+ + + DAD++ PK+      S E +EGNGGPGTIKK+T  
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGG-SIGKLTL 117
            E  E K++ HKVE ID AN+ Y YS++ G  L  T EKI++E K+   P+GG SI K+T 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            KYHTKG+A  +EEE+K GK K  GLF+A+E Y+LA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 11. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 142.1 bits 545,  Expect = 7e-36
 Identities = 85/157 54%, Positives = 113/157 71%, Gaps = 3/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF++EDE TS +PPA+L+ + + DAD++ PK+      S E +EGNGGPGTIKK+T  
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGG-SIGKLTL 117
            E  E K++ HKVE ID AN+ Y YS++ G  L  T EKI +E K+   P+GG SI K+T 
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            KYHTKG+A  +EEE+K GK K  GLF+A+E Y+LA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 12. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 141.1 bits 541,  Expect = 1e-35
 Identities = 84/157 53%, Positives = 112/157 71%, Gaps = 3/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF++EDE TS +PPA+L+ + + DAD++ PK+        E +EGNGGPGTIKK+T  
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGG-SIGKLTL 117
            E  E K++ HKVE ID AN+ Y YS++ G  L  T EKI++E K+   P+GG SI K+T 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            KYHTKG+A   EEE+K GK K  GLF+A+E Y+LA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 13. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 140.4 bits 538,  Expect = 2e-35
 Identities = 84/157 53%, Positives = 111/157 70%, Gaps = 3/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +EDE TS +PPA+L+ + + DAD++ PK+        E +EGNGGPGTIKK+T  
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGG-SIGKLTL 117
            E  E K++ HKVE ID AN+ Y YS++ G  L  T EKI++E K+   P+GG SI K+T 
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            KYHTKG+A   EEE+K GK K  GLF+A+E Y+LA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 14. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 137.1 bits 525,  Expect = 2e-34
 Identities = 80/157 50%, Positives = 113/157 71%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT E+EITS +PP +L+ A + DAD++ PK+    +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  + K++ H+++ ID+AN+ Y YSV+ G  +    EKI++E K+V  P+GGSI K T K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE++  GK K  GLF+A+E Y+LA+   Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 15. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 135.6 bits 519,  Expect = 6e-34
 Identities = 77/157 49%, Positives = 112/157 71%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E T+ + PA+L+ A + DAD++ PK+    +KS EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++ ID AN+ Y  +++ G A+  T EKI +E KLV  P+GGSI K T K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  E+++K GK +  G+F+A+E Y+LANP  Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 16. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 134.7 bits 515,  Expect = 1e-33
 Identities = 81/157 51%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    VK  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+GG+I K T K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 17. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 134.4 bits 514,  Expect = 1e-33
 Identities = 80/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +PPA+L+   + D+D++ PK+    +KS+EI+EGNGGPGTIKK+   
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     +I +KVE ID+AN++Y YSV+ G AL    EKI +E K+V  P+GGSI K   K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHT GD +  +E++K GK K  GLF+A+EGY+LA+   Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 18. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 134.2 bits 513,  Expect = 2e-33
 Identities = 80/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    VK  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+GG++ K T K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 19. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 134.2 bits 513,  Expect = 2e-33
 Identities = 80/157 50%, Positives = 111/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++SID+ NY+Y+Y+++ G AL  T EKI++ETKLV  P+GGSI K T  
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K   LF+ IE Y+  +P  Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 134.2 bits 513,  Expect = 2e-33
 Identities = 80/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+GG+I K T K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 21. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 133.4 bits 510,  Expect = 3e-33
 Identities = 78/157 49%, Positives = 109/157 69%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIV 58
            MG+FT+ DE TS +PP +L+ A+  +AD++ PKI    VKS EIVEG+GG GTIKK++  
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ H+++ +D+ N+ YNYS+V G AL    EKI++E KLV   +GGS+ K T  
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE++K GK K  GLF+ IE Y++ANP  Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 22. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 132.9 bits 508,  Expect = 4e-33
 Identities = 79/157 50%, Positives = 110/157 70%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++SID+ N++Y+Y+++ G AL    EKI++ETKLV  P+GGSI K T  
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IE Y+  +P  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 23. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 132.4 bits 506,  Expect = 6e-33
 Identities = 78/156 50%, Positives = 114/156 73%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GKAK  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 24. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 132.4 bits 506,  Expect = 6e-33
 Identities = 78/157 49%, Positives = 108/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PP KL+ A + DAD++ PK+    VK  EI+EG+GG GTIKK+T  
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+V+ ID+ N +Y+Y+++ G AL    E I ++ KLV  P+GGSI K T  
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE++K GK K  GLF+ +E Y+LANP  Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 25. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 131.9 bits 504,  Expect = 8e-33
 Identities = 79/156 50%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 26. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 131.9 bits 504,  Expect = 8e-33
 Identities = 79/156 50%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 27. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 131.9 bits 504,  Expect = 8e-33
 Identities = 79/157 50%, Positives = 109/157 69%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MG +T+E+E TS +P  KL+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+GG+I K T K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 131.2 bits 501,  Expect = 1e-32
 Identities = 77/156 49%, Positives = 113/156 72%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 29. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 131.2 bits 501,  Expect = 1e-32
 Identities = 77/156 49%, Positives = 113/156 72%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YH KG+ +  EE +K GK KG GLF+ IE Y+  +P  Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 30. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 130.9 bits 500,  Expect = 2e-32
 Identities = 78/156 50%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKL+     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLM-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 31. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 130.7 bits 499,  Expect = 2e-32
 Identities = 77/156 49%, Positives = 113/156 72%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 32. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 130.7 bits 499,  Expect = 2e-32
 Identities = 78/156 50%, Positives = 108/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+   + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 33. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 130.4 bits 498,  Expect = 2e-32
 Identities = 78/156 50%, Positives = 108/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGT KK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 34. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 130.4 bits 498,  Expect = 2e-32
 Identities = 78/156 50%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE ++  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 35. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 130.2 bits 497,  Expect = 3e-32
 Identities = 77/156 49%, Positives = 113/156 72%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 36. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 129.9 bits 496,  Expect = 3e-32
 Identities = 78/156 50%, Positives = 108/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +  GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 37. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 129.9 bits 496,  Expect = 3e-32
 Identities = 77/156 49%, Positives = 112/156 71%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 38. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 129.7 bits 495,  Expect = 4e-32
 Identities = 77/156 49%, Positives = 110/156 70%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MG++TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+V+SIDEA+Y+Y Y+++ G AL  T EKI++E KLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 39. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 129.4 bits 494,  Expect = 4e-32
 Identities = 80/156 51%, Positives = 109/156 69%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+T+E+E TS +P  KL+ A + DAD++ PKI    VK  EI+EG+GGPGTIKK+T  
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK+ SID+ N+ Y+YS++ G AL    EKI +ETKLV  P+G +I K T K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IEGY+  +P++Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 40. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 129.2 bits 493,  Expect = 5e-32
 Identities = 76/156 48%, Positives = 112/156 71%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T E I++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 41. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 129.2 bits 493,  Expect = 5e-32
 Identities = 77/156 49%, Positives = 112/156 71%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 42. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 128.9 bits 492,  Expect = 6e-32
 Identities = 78/157 49%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D +++ PK+    V SVE VEGNGGPGTIKK+T  
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +VE +D  N+ Y+Y+V+ G  +    EKI  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD + D E +K GK K EGLFRA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 43. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 128.7 bits 491,  Expect = 7e-32
 Identities = 77/156 49%, Positives = 112/156 71%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV TFE+E TS +PP++L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 44. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 128.0 bits 488,  Expect = 1e-31
 Identities = 77/155 49%, Positives = 108/155 69%, Gaps = 3/155 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GV+T+E+E TS +PP +L+ A + DAD++ PKI    +K  EI+EG+GGPGTIKK+T  E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
              +  ++ HK++S+DEANY+Y Y+++ G AL  T EK+++ETKLV     GSI K    Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 119
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            HTKGD +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 45. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 128.0 bits 488,  Expect = 1e-31
 Identities = 78/156 50%, Positives = 106/156 67%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IE Y+L +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 46. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 128.0 bits 488,  Expect = 1e-31
 Identities = 77/157 49%, Positives = 107/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 47. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 127.0 bits 484,  Expect = 2e-31
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 48. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 126.7 bits 483,  Expect = 3e-31
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 126.5 bits 482,  Expect = 3e-31
 Identities = 77/156 49%, Positives = 106/156 67%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK+T  E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E KLV  P+GGSI K++ KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            HTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 50. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 126.5 bits 482,  Expect = 3e-31
 Identities = 74/157 47%, Positives = 109/157 69%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E  S +PPA+L+ A + D+D++ PK++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K   H+++ ID  N+ Y++SV+ G AL    E ++ ETK+V  P+GGSI K T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKGD +  +E ++ GK K   +F+A+E Y++A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 126.5 bits 482,  Expect = 3e-31
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 52. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 126.5 bits 482,  Expect = 3e-31
 Identities = 77/157 49%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E KLV  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K K E L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 53. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 125.0 bits 476,  Expect = 1e-30
 Identities = 77/156 49%, Positives = 105/156 67%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IE Y+L +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 54. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 125.0 bits 476,  Expect = 1e-30
 Identities = 75/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E KLV  P+GGSI +++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K  K KGE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 55. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 125.0 bits 476,  Expect = 1e-30
 Identities = 72/157 45%, Positives = 108/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV  +E E  S +PPA+L+ A + D+D++ PK++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K   H+++ ID  N+ +++SV+ G AL    E ++ ETK+V  P+GGSI K T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKGD +  +E ++ GK K  G+F+A+E Y++A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 56. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 124.5 bits 474,  Expect = 1e-30
 Identities = 74/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GGSI K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 57. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 124.5 bits 474,  Expect = 1e-30
 Identities = 73/157 46%, Positives = 108/157 68%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT E + TS + PA+L+ A+  D+D++  K++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K   H+++ ID  N+ Y++SV+ G AL    E ++ ETK+V  P+GGSI K T K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKGD +  +E ++ GK K  G+F+A+E Y++A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 58. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 124.5 bits 474,  Expect = 1e-30
 Identities = 74/157 47%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D +++ PK+    V SVE VEGNGGPGTIKK+T  
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +VE +D  N+ Y+Y+V+ G  +    EKI  E K+V  P+GGSI K+T K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K GK + EGL++ +E Y+LA+  +Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 59. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 124.0 bits 472,  Expect = 2e-30
 Identities = 74/157 47%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P  +L+ A + D D++ PKI    +KS EI+EG+GG GTIKK+T  
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ ++V  ID+ N+ Y+YS++ G  L    EKIT+ETKL+  P+GGSI K T  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YH KGD +  EE +K GK K  GLF+ +E Y+LA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 60. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 123.7 bits 471,  Expect = 2e-30
 Identities = 78/156 50%, Positives = 104/156 66%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS +PPA+LYNA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ HK++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K    
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSISH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +  EE +K GK K   LF+ IE Y+L +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 61. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 123.7 bits 471,  Expect = 2e-30
 Identities = 74/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GGSI K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 62. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 123.7 bits 471,  Expect = 2e-30
 Identities = 74/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GGSI K++ K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 63. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 123.5 bits 470,  Expect = 3e-30
 Identities = 74/157 47%, Positives = 106/157 67%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GGSI K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 64. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 123.2 bits 469,  Expect = 3e-30
 Identities = 76/156 48%, Positives = 104/156 66%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTK D +  EE +K GK K   LF+ IE Y+LA+   Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 65. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 123.2 bits 469,  Expect = 3e-30
 Identities = 74/157 47%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D + + PK+    V SVE VEGNGGPGTIKK+T  
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +VE +D  N+ Y+Y+V+ G  +    EKI  E K+V  P+GGSI K+T K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E +K GK + EGL++ +E Y+LA+  +Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 66. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 123.0 bits 468,  Expect = 4e-30
 Identities = 74/157 47%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+YSV+ G  +  T EKI+ E K+V  PNGGSI K+  K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 67. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 122.7 bits 467,  Expect = 5e-30
 Identities = 74/157 47%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+YSV+ G  +  T EKI+ E K+V  PNGGSI K+  K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 68. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 122.3 bits 465,  Expect = 6e-30
 Identities = 73/156 46%, Positives = 110/156 70%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV+ +E + TS +PPA+L+ A + D+D++  K++   VKS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  + K+  H+++++D  N +Y++SV+ G AL   A  I+ E K+V  P+GGSI K T K
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTK 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKG  +  EE+++    KG GLF+A+E Y+LA+P  Y
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 69. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 122.2 bits 465,  Expect = 6e-30
 Identities = 74/157 47%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+YSV+ G  +  T EKI+ E K+V  PNGGSI K+  K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 70. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 121.8 bits 463,  Expect = 9e-30
 Identities = 73/157 46%, Positives = 103/157 65%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P  +L+ A + D D++ PKI    +KS EI+EG+GG GTIKK+T  
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ ++V  ID+ N+ Y+YS++ G  L    EKIT+ETKL+  P+GGSI K T  
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y  KGD +  EE +K GK K  GLF+ +E Y+LA+   Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 71. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 121.8 bits 463,  Expect = 9e-30
 Identities = 72/157 45%, Positives = 103/157 65%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P  +L+ A + D D++ PKI    +KS +I+EG+GG GTIKK+T  
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  +  ++ ++V  ID+ N+ Y+YS++ G  L    EKIT+ETKL+  P+GGSI K    
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YH KGD +  EE +K GK K  GLF+ +E Y+LA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 72. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 121.0 bits 460,  Expect = 2e-29
 Identities = 73/157 46%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GGSI K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K   E L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 73. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 120.5 bits 458,  Expect = 2e-29
 Identities = 72/156 46%, Positives = 106/156 67%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                K++  +V+ +D AN+ Y+YS++ G  +  T EKI+ E K+V  P+GGSI K++ KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            HTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 74. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 120.5 bits 458,  Expect = 2e-29
 Identities = 70/157 44%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 75. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 120.5 bits 458,  Expect = 2e-29
 Identities = 70/157 44%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 76. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 120.5 bits 458,  Expect = 2e-29
 Identities = 71/157 45%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 77. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 120.5 bits 458,  Expect = 2e-29
 Identities = 70/157 44%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 78. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 120.3 bits 457,  Expect = 3e-29
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGS+ K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 79. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 120.3 bits 457,  Expect = 3e-29
 Identities = 71/157 45%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 80. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 119.8 bits 455,  Expect = 4e-29
 Identities = 72/156 46%, Positives = 101/156 64%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E TS +P A+L+ A + D + + PK+    V SVE VEGNGGPGTIKK+T  E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                K++  +VE ID  N+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            H KG  + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 81. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 119.8 bits 455,  Expect = 4e-29
 Identities = 70/157 44%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 82. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 119.8 bits 455,  Expect = 4e-29
 Identities = 70/157 44%, Positives = 105/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ A + D D + PK+  + V SVE +EGNGGPGTIKK+T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y++SV+ G A+    EK+  E K+V  P+GGSI K++ K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +HTKGD + + E++K  K K  GL++A+E Y+LA+   Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 83. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 119.5 bits 454,  Expect = 4e-29
 Identities = 70/157 44%, Positives = 103/157 65%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+++ A + D D + PK+    + SVE +EGNGGPGTIKK+   
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 84. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 119.5 bits 454,  Expect = 4e-29
 Identities = 71/157 45%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK+   
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 85. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 119.3 bits 453,  Expect = 5e-29
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + E++K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 86. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 119.3 bits 453,  Expect = 5e-29
 Identities = 69/157 43%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    +  VE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 87. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 119.0 bits 452,  Expect = 6e-29
 Identities = 70/157 44%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +    EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 88. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 119.0 bits 452,  Expect = 6e-29
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + E++K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 89. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 118.8 bits 451,  Expect = 7e-29
 Identities = 71/148 47%, Positives = 101/148 68%, Gaps = 2/148 1%
Query  4    FTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVEDG 61
            F +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+T  E  
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  62   ETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHT 121
              K++  +V+ +D AN+ Y+YS++ G AL  T EKI  E K+V  P+GGSI K++ KYHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  122  KGDAKPDEEELKKGKAKGEGLFRAIEGYVL 151
            KGD +   E +K  K KGE L+RA+E Y+L
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 90. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 118.8 bits 451,  Expect = 7e-29
 Identities = 70/157 44%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + + D++ PK+    + SVE +EGNGGPGTIKK+   
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 91. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 118.3 bits 449,  Expect = 1e-28
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 92. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 118.3 bits 449,  Expect = 1e-28
 Identities = 70/157 44%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
                 K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG + K++ K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKG+ +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 93. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 118.3 bits 449,  Expect = 1e-28
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + E++K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 94. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 118.0 bits 448,  Expect = 1e-28
 Identities = 69/156 44%, Positives = 104/156 66%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E  S +P A+L+ A + D D + PK+  + V SVE +EGNGGPGTIKK+T  E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                K++  +V+ +D  N+ Y++SV+ G A+    EK+  E K+V  P+GGSI K++ K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            HTKGD + + E++K  K K  GL++A+E Y+LA+   Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 95. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 118.0 bits 448,  Expect = 1e-28
 Identities = 72/157 45%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIID-DVKSVEIVEGNGGPGTIKKLTIV 58
            MGV TF  E T+T+ P +L+  +  D DS+ PK++  DVKS+EIVEG+GG G+IK++  V
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E G  K++ HK+  ID+ N    YS++ G  L    E I ++ K+    +GG + K T +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD    EEE   GK K   LF+AIE Y+LANP+ Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 96. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 118.0 bits 448,  Expect = 1e-28
 Identities = 69/157 43%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ Y+Y+V+ G  L    EK++ E K+V  P GGSI K++ K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 97. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 117.5 bits 446,  Expect = 2e-28
 Identities = 68/157 43%, Positives = 102/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ ++Y+V+ G  L    EK+++E K+V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 98. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 117.0 bits 444,  Expect = 2e-28
 Identities = 71/157 45%, Positives = 104/157 66%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E TS +P A+L+ A + D D++ PK+    + SVE +EGNGGPGTIKK++  
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +   N+ Y+YSV+ G  +  T EKI+ E K+V  P+G SI K++ K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD +   E++K  K  GE L+RA+E Y+LA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 99. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 116.8 bits 443,  Expect = 3e-28
 Identities = 70/156 44%, Positives = 107/156 68%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT E + TS + PA+L+ A+  D+D++  K++   +KS EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  + K+  H+++++D  N  Y++SV+ G AL    E ++ E K V  P+GGSI K T K
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKGD +  EE+++    K  GL++A+E Y++A+P  Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 100. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 116.5 bits 442,  Expect = 3e-28
 Identities = 68/157 43%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 101. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 116.0 bits 440,  Expect = 5e-28
 Identities = 68/156 43%, Positives = 99/156 63%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            H KG  + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 102. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 115.8 bits 439,  Expect = 6e-28
 Identities = 68/157 43%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 103. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 115.1 bits 436,  Expect = 9e-28
 Identities = 70/156 44%, Positives = 107/156 68%, Gaps = 3/156 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV T E + TS +PPA+L+ A + D+D++ PK++   +KS+E +EGNGGPGTIKK+T  
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  + K+  H+++++D  N  Y++SV+ G AL      ++ E K+V  P+GGSI K T K
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            Y+TKGD +  EE+++    K  GL +A+E Y+LA+P  Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 104. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 115.0 bits 436,  Expect = 1e-27
 Identities = 67/157 42%, Positives = 101/157 64%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +P A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    KF+  +V+ +D AN+ ++Y+V+ G  L    EK+++E  +V  P GGSI K++ K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 105. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 115.0 bits 436,  Expect = 1e-27
 Identities = 69/157 43%, Positives = 109/157 69%, Gaps = 3/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVFT+E E TS++ PA+L+ A + D D++ PKI    V+ VEI+EGNGG GTIKK+T  
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTA-EKITFETKLVEGPNGGSIGKLTL 117
            +    K++ HK+E+ID+ +  Y+YS++ G AL     EKIT E+KLV   +GG++ K   
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            KY++ GDA+ +EE++K+G+ +   +++ +E Y+  +P  Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 106. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 114.8 bits 435,  Expect = 1e-27
 Identities = 67/156 42%, Positives = 99/156 63%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E  S +P A+L+ + + D D + PK+    + SVE VEGNGGPGTIK +T  E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGSI K++ K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 107. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 114.1 bits 432,  Expect = 2e-27
 Identities = 68/156 43%, Positives = 99/156 63%, Gaps = 2/156 1%
Query  2    GVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIVE 59
            GVF +E E  S +P A+L+ + + D D + PK+   V  SVE V GNGGPGTIK +T  E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
                KF+  +V+ +D AN+ YNY+V+ G  L    EK++ E K+V  P GGSI K++ K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            H KG  + + E++K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 108. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 112.8 bits 427,  Expect = 4e-27
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 2/154 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV T++ EI S VPP KLY A + D D++ PK++   +K V+I+EG+G  GTIK++T  
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K + ++V++ID+ N  Y+Y+++ G  L    E I++  K+V  P+GGSI K    
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            Y TKGD K  EEE+K GK K   +F+A+E Y+LANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 111.4 bits 421,  Expect = 1e-26
 Identities = 66/148 44%, Positives = 98/148 66%, Gaps = 2/148 1%
Query  4    FTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVEDG 61
            F +E E TS +P A+L+ A + D D++ PK+    + SV+ +EGNGGPGTIKK+   E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  62   ETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHT 121
              K++  +V+ +D  N+ YNYSV+ G  +  T EKI+ E K+V  P+GG I K++ KYHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  122  KGDAKPDEEELKKGKAKGEGLFRAIEGYVL 151
            KG+ +   E++K  K  GE L+RA+E Y+L
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 110. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 109.3 bits 413,  Expect = 5e-26
 Identities = 65/157 41%, Positives = 97/157 61%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGVF +E E  S +  A+L+ + + D D + PK+    + SVE V GNGGPGTIK +T  
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K++  +V+ +D  N+ Y+Y+V+ G  L    EK+  E K+V  P GGS  K++ K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            +H KGD + + EE+K  K   E L+RA+E Y+LA+  +Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 111. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 106.1 bits 400,  Expect = 5e-25
 Identities = 64/157 40%, Positives = 98/157 62%, Gaps = 2/157 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV T+  E T+T+ P +L+ A+  D D++ PK++   VK+ E +EG+GG G+IK++  V
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E G  K++ HK+  ID+ N    YS++ G  L    E IT++ K+    NGG + K T +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157
            YHTKGD    EEE   G+ +   + +A+E Y+LANP+ Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 103.5 bits 389,  Expect = 2e-24
 Identities = 64/133 48%, Positives = 90/133 67%, Gaps = 3/133 2%
Query  11   TSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVEDGETKFILH 68
            TS +PP KL+ A + DAD++ PKI    VKSVEI+EG+GG GT+KK+ + E  E  ++ H
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  69   KVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPD 128
            K++ +D+ N+ Y+YS+  G AL    EKI++E KLV     GSI K T  YH KG A+  
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLV-ASGRGSIIKTTSHYHCKGGAEIK 120
Query  129  EEELKKGKAKGEGLFR 144
            EE++K GK +  GLF+
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 113. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 99.7 bits 374,  Expect = 4e-23
 Identities = 61/153 39%, Positives = 95/153 62%, Gaps = 3/153 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MG  T++ EI S++   K++ A + D D+I PK +   +  V+ +EG+GG GTIK  T  
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E    K + H+++ +D+ N+ Y+YS++ G AL    E I++  K+V  P+GG I K    
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALD-VFESISYHIKIVATPDGGCICKNRSI 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            Y  K DA+  EEE+K GK +  G+F+ +E Y+LANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 93.1 bits 348,  Expect = 4e-21
 Identities = 57/144 39%, Positives = 87/144 60%, Gaps = 2/144 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV T+  E T+T+ P +L+ A+  D D++ PK++   VK+ E +EG+GG G+IK++  V
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E G  K++ HK+  ID+ N    YS++ G  L    E IT++ K+    NGG + K T +
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFR 144
            YHTKGD    EEE   G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 86.8 bits 322,  Expect = 3e-19
 Identities = 62/152 40%, Positives = 91/152 59%, Gaps = 3/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV     E  STV   K+Y   + D D++ PK++   +KSVEI+EG+GG GT+K + + 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E  E   + +KV+ ID+A  AY Y+ +GG  L    E +  E  +V   +GG I K T  
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVP-TDGGCIVKNTTI 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            Y+TKGDA   E+++K+   K    F+A+E Y+LAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 116. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 86.0 bits 319,  Expect = 5e-19
 Identities = 58/152 38%, Positives = 89/152 58%, Gaps = 3/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MGV T   E+TS+V   K++   + D D++ PK      KSVEI +G+GGPGT+K +T+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            + G    +  +++ +++    ++YSV+ G  L    E I     LV   +GGSI K T  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            +HTKGDA   EE +K    +   LF+A+E Y++AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 85.3 bits 316,  Expect = 8e-19
 Identities = 61/151 40%, Positives = 92/151 60%, Gaps = 5/151 3%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV   E E  STV   K+Y   + D D++ PK++   +KSVEI+EG+GG GT++ + + 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGP-NGGSIGKLTL 117
            E  E   + +KV+ ID+A   Y Y+ +GG  L    E +    ++V  P +GG I K T 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV--NQFVVVPTDGGCIVKNTT 118
Query  118  KYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
             Y+TKGDA   E+++K+   K    F+A+E Y+LAN
Sbjct  119  IYNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 84.8 bits 314,  Expect = 1e-18
 Identities = 55/153 35%, Positives = 92/153 60%, Gaps = 2/153 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
            MGV   E  ITS+VP AKL+ A+  D D++ P+++   +K  EI+EG+GG GT+K +T+ 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            +    K + +K+++ID+  + ++YS++ G  L    + I     +V   +GG     T  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            ++TKGDA   EE +K    +   +F+A+E Y+LAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 80.1 bits 295,  Expect = 3e-17
 Identities = 55/152 36%, Positives = 90/152 59%, Gaps = 4/152 2%
Query  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            M V  FE  ITS++ P+ ++ A + D D+I PK   +  KS++ +EG+GG GTIK +T  
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            +        HKV++ID  N++ +Y++  G  L    E  T   K++   +GGS+ K ++ 
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154
            +  KGDAK  +E +   K   +  F+AIE YV+++P
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 79.8 bits 294,  Expect = 4e-17
 Identities = 55/152 36%, Positives = 88/152 57%, Gaps = 3/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MG  +   EITS+V   K+++ +  D D++ PK      KSVE V+G+GG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E      +  + +++++   +Y+ +V+ G  L    E I     +V   +GGSI K T  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 79.6 bits 293,  Expect = 4e-17
 Identities = 59/150 39%, Positives = 90/150 60%, Gaps = 7/150 4%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MG  +   EITS+V   K+++ +  D D++ PK      KSVE V+G+GG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGP--NGGSIGKLT 116
            E      +  + +++++    Y+ +V+ G  L    E I  ET LV  P  +GGSI K T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  117  LKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
              +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 78.6 bits 289,  Expect = 9e-17
 Identities = 54/152 35%, Positives = 87/152 57%, Gaps = 3/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MG  +   EITS+V   K+++ +  D D++ PK      KSV+ V+G+GG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E      +  + +++++    Y+ +V+ G  L    E I     +V   +GGSI K T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 77.8 bits 286,  Expect = 2e-16
 Identities = 54/152 35%, Positives = 86/152 56%, Gaps = 3/152 1%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MG  +   EITS+V   K++  +  D D++ PK      KSV+ V+G+GG GT++ +T+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
            E      +  + +++++    Y+ +V+ G  L    E I     +V   +GGSI K T  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
            +HTKGDA   EE +K   A+   LF+AIE Y++AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 77.1 bits 283,  Expect = 2e-16
 Identities = 57/150 38%, Positives = 89/150 59%, Gaps = 7/150 4%
Query  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIIDDV-KSVEIVEGNGGPGTIKKLTIV 58
            MG  +   EITS+V   K+++ +  D D++ PK      KSV+ V+G+GG GT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGP--NGGSIGKLT 116
            E      +  + +++++    Y+ +V+ G  L    E I  ET LV  P  +GGSI K T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  117  LKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLAN 153
              +HTKGDA   EE +K    +   LF+AIE Y++AN
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 66.0 bits 237,  Expect = 4e-13
 Identities = 40/78 51%, Positives = 50/78 64%, Gaps = 0/78 0%
Query  80   YNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKG 139
            Y Y  V G AL  T EKI +ETKLV  P+  +I K T KYHTKGD +  EE +K GK K 
Sbjct  22   YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  140  EGLFRAIEGYVLANPTQY 157
              LF+ IEGY+  +P++Y
Sbjct  82   AHLFKLIEGYLKDHPSEY 99

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 46.3 bits 156,  Expect = 1e-07
 Identities = 24/48 50%, Positives = 36/48 75%, Gaps = 2/48 4%
Query  2    GVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGGP 49
            GVFT E + TS + PA+L+ A+  D+D++  K++   +KS EI+EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 37.4 bits 123,  Expect = 0.0002
 Identities = 34/122 27%, Positives = 62/122 50%, Gaps = 10/122 8%
Query  24   KDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNY 82
            KD  ++ PK++   VK V+++EG+GG GTI  +  + +    +   ++   DE+++    
Sbjct  24   KDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHEIGL 83
Query  83   SVVGGVALPP--TAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGE 140
             V+ G  L    +  K TF  KL E     ++  + + Y    D    EE++   K    
Sbjct  84   QVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKISYDHDSDI---EEKVTPTKTSQS 138
Query  141  GL--FRAIEGYV 150
             L  +R +E Y+
Sbjct  139  TLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.