The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAO25113 Mal d 1.0304 159 1013 258.3 7.1e-71
AAK13027 Mal d 1.0302 159 994 253.6 1.9e-69
CAA96534 Mal d 1.0301 159 979 249.9 2.5e-68
AAK13028 Mal d 1.0303 159 966 246.7 2.3e-67
O24248 Pru av 1 160 840 215.4 6.1e-58
Q2I6V8 Pru p 1.0101 160 836 214.4 1.2e-57
AAD26545 Mal d 1.0202 159 835 214.1 1.4e-57
AAB01362 Mal d 1.0201 159 835 214.1 1.4e-57
AAD26548 Mal d 1.0204 159 831 213.1 2.8e-57
AAD13683 Mal d 1.0206 159 830 212.9 3.4e-57
CAD32318 Mal d 1.0208 158 829 212.6 4e-57
AAK13030 Mal d 1.0207 159 829 212.6 4e-57
AAD26547 Mal d 1.0203 159 829 212.6 4e-57
AAD26558 Mal d 1.0205 159 827 212.1 5.7e-57
AAD29671 Mal d 1.0108 159 823 211.2 1.1e-56
O65200 Pyr c 1 159 821 210.7 1.6e-56
CAA58646 Mal d 1.0101 159 818 209.9 2.7e-56
AAD26546 Mal d 1.0103 159 818 209.9 2.7e-56
AAD26553 Mal d 1.0105 159 817 209.7 3.2e-56
AAD26552 Mal d 1.0104 159 817 209.7 3.2e-56
AAD26554 Mal d 1.0106 159 817 209.7 3.2e-56
AAK13029 Mal d 1.0109 159 812 208.4 7.5e-56
B6CQS9 Pru du 1.0101 160 810 207.9 1.1e-55
O50001 Pru ar 1 160 809 207.7 1.3e-55
AAD26555 Mal d 1.0107 159 807 207.2 1.8e-55
CAA96536 Mal d 1.0402 160 800 205.4 6e-55
CAA96535 Mal d 1.0401 160 800 205.4 6e-55
CAA96537 Mal d 1.0403 160 800 205.4 6e-55
Q256S4 Fra a 1 159 798 204.9 8.3e-55
CAA88833 Mal d 1.0102 159 798 204.9 8.3e-55
APD76154 Jug r 5.0101 160 794 203.9 1.7e-54
Q3T923 Fra a 1 160 790 203.0 3.3e-54
Q256S7 Fra a 1 160 788 202.5 4.7e-54
Q256S2 Fra a 1 160 780 200.5 1.9e-53
Q256S6 Fra a 1 160 779 200.2 2.2e-53
CAD10374 Cas s 1 160 738 190.0 2.6e-50
ACJ23864 Fag s 1.0101 160 737 189.8 3.1e-50
CAA96549 Cor a 1.0301 160 705 181.8 7.5e-48
CAA54696.1 Bet v 1.0301 160 690 178.1 1e-46
Q0Z8U9 Rub i 1.0101 137 685 177.0 1.8e-46
ABZ81046 Que a 1.0301 160 686 177.1 2e-46
AFN42528 Can s 5.0101 161 680 175.6 5.6e-46
AAD48405 Cor a 1.0401 161 674 174.1 1.6e-45
AAG40331 Cor a 1.0404 161 671 173.4 2.6e-45
AAG40329 Cor a 1.0402 161 671 173.4 2.6e-45
AAG40330 Cor a 1.0403 161 668 172.7 4.4e-45
AUH28179 Que m 1.0101 160 662 171.2 1.2e-44
Q39427 Bet v 1.0205 160 649 167.9 1.2e-43
P43186 Bet v 1.0204 160 644 166.7 2.7e-43
ABZ81047 Que a 1.0401 160 642 166.2 3.9e-43
CAA04828.1 Bet v 1.0206 159 640 165.7 5.4e-43
CAA07329.1 Bet v 1.0118 160 638 165.2 7.7e-43
CAA54481 Bet v 1.0202 160 632 163.7 2.2e-42
CAA96548 Cor a 1.0201 160 632 163.7 2.2e-42
P43184 Bet v 1.0203 160 631 163.5 2.6e-42
CAB02160 Bet v 1.0113 160 629 163.0 3.6e-42
CAA33887 Bet v 1.0101 160 628 162.7 4.3e-42
CAA54421 Bet v 1.0201 160 628 162.7 4.3e-42
CAB02159 Bet v 1.0112 160 628 162.7 4.3e-42
CAB02156 Bet v 1.0109 160 627 162.5 5.1e-42
CAB02161 Bet v 1.0114 160 626 162.2 6.1e-42
CAA54485 Bet v 1.0105 160 624 161.7 8.5e-42
CAA54487 Bet v 1.0106 160 624 161.7 8.5e-42
CAA54483 Bet v 1.0103 160 623 161.5 1e-41
CAA54482 Bet v 1.0102 160 621 161.0 1.4e-41
CAA54484 Bet v 1.0104 160 619 160.5 2e-41
QOL10866 Que ac 1.0101 159 618 160.2 2.4e-41
CAA96547 Bet v 1.0115 160 618 160.2 2.4e-41
CAA07323.1 Bet v 1.0117 160 617 160.0 2.8e-41
CAA54489 Bet v 1.0107 160 616 159.7 3.4e-41
CAB02155 Bet v 1.0108 160 616 159.7 3.4e-41
CAA04827.1 Bet v 1.0116 159 615 159.5 4e-41
QGS84240 Que i 1.0101 159 614 159.3 4.7e-41
ABZ81045 Que a 1.0201 159 614 159.3 4.7e-41
CAA50325 Cor a 1.0103 160 611 158.5 8e-41
CAB02157 Bet v 1.0110 160 611 158.5 8e-41
CAB02217 Car b 1.0302 161 609 158.0 1.1e-40
CAB02158 Bet v 1.0111 160 608 157.8 1.3e-40
AAB24432 Aln g 1 160 605 157.0 2.2e-40
CAA50327 Cor a 1.0101 160 599 155.5 6.3e-40
P38948 Aln g 1 159 598 155.3 7.4e-40
CAB02216 Car b 1.0301 161 596 154.8 1.1e-39
CAB02207 Car b 1.0104 160 594 154.3 1.5e-39
CAB02206 Car b 1.0103 160 593 154.0 1.8e-39
Q08407 Cor a 1 159 592 153.8 2.1e-39
CAA50328 Cor a 1.0102 160 592 153.8 2.1e-39
CAB02208 Car b 1.0105 160 590 153.3 3e-39
ABZ81041 Car b 1.0110 160 584 151.8 8.3e-39
ABZ81043 Car b 1.0112 160 583 151.5 9.9e-39
ABZ81042 Car b 1.0111 160 583 151.5 9.9e-39
ACF75030.1 Bet v 1.0207 150 582 151.4 1.1e-38
ABZ81040 Car b 1.0109 160 581 151.1 1.4e-38
CAB02209 Car b 1.0106 160 580 150.8 1.7e-38
P38950 Car b 1 159 576 149.8 3.3e-38
ADK39021 Ost c 1.0101 160 576 149.8 3.3e-38
CAM31908 Act c 8.0101 159 575 149.6 3.9e-38
ABZ81044 Car b 1.0113 160 575 149.6 3.9e-38
CAA50326 Cor a 1.0104 160 568 147.8 1.3e-37
CAB02213 Car b 1.0107 160 566 147.3 1.8e-37
CAA47357 Car b 1.0102 159 565 147.1 2.2e-37
ABC41615.1 Bet v 1.0119 150 561 146.1 3.9e-37
CAB02215 Car b 1.0108 160 556 144.8 1e-36
P38949 Car b 1 159 552 143.9 2e-36
CAM31909 Act d 8.0101 157 545 142.1 6.7e-36
NP_001275580 Sola l 4.0201 160 516 134.9 1e-33
AHC08073 Sola l 4.0101 160 505 132.2 6.7e-33
CAA42646 Gly m 4 158 495 129.7 3.7e-32
AAQ91847 Ara h 8.0101 157 488 128.0 1.2e-31
CAA43637 Pha v 1 156 478 125.5 6.7e-31
P25985 Pha v 1 155 471 123.8 2.2e-30
CAA43636 Pha v 1 155 465 122.3 6.2e-30
CAA75803 Lyc e 4.0101 178 458 120.4 2.6e-29
Q2VU97 Vig r 1.0101 155 455 119.8 3.5e-29
EF436550 Ara h 8.0201 153 452 119.1 5.7e-29
CAA67246 Pet c PR10 155 433 114.3 1.5e-27
AAL76932 Dau c 1.0201 154 424 112.1 7.2e-27
P92918 Api g 1.0201 159 423 111.8 8.9e-27
AAB92255 Tar o RAP 157 412 109.1 5.8e-26
P49372 Api g 1 154 405 107.4 1.9e-25
BAA13604 Dau c 1.0102 154 379 100.9 1.7e-23
CAB03716 Dau c 1.0104 154 379 100.9 1.7e-23
CAB06416 Dau c 1.0105 154 376 100.2 2.8e-23
AAB01092 Dau c 1.0101 168 376 100.1 3.2e-23
Q5ULZ4 Fra a 1.0101 100 362 97.1 1.5e-22
CAB03715 Dau c 1.0103 154 361 96.5 3.7e-22
P85126 Que a 1.0101 50 225 63.7 8.6e-13
Q9ZWP8 Vig r 6.0101 155 174 50.0 3.5e-08
Q9S8Q4 Cas s 1 24 126 39.8 6.6e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 258.3 bits 1013,  Expect = 7e-71
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 253.6 bits 994,  Expect = 2e-69
 Identities = 156/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDK+NFVYKYSVIEGDAISETIEKISYETKLVA+GSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEH DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 249.9 bits 979,  Expect = 2e-68
 Identities = 154/159 96%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTK DVEIKEEHVKAGKEKASHLFKLIENYLL H DAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 246.7 bits 966,  Expect = 2e-67
 Identities = 151/159 94%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE EFTSVIPPARL+NAFVLDADNLIPKIAPQAVKS EILEGDGGVGTIKKINFG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGSTYSYVKH+IDGVDK+NFVY+YSVIEGDAISETIEKISYETKLVASGSGSVIKS SHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEH DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 5. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 215.4 bits 840,  Expect = 6e-58
 Identities = 129/159 81%, Positives = 143/159 89%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DKEN+ Y Y++IEGDA+ +T+EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+VEIKEEHVKAGKEKAS+LFKLIE YL  HPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 6. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 214.4 bits 836,  Expect = 1e-57
 Identities = 129/159 81%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS IPP RLF AFVLDADNL+PKIAPQA+K +EILEGDGG GTIKKI FG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS Y YVKH+ID +DKEN  Y Y++IEGDA+ + +EKISYETKLVAS SG S+IKSTSH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEEHVKAGKEKAS+LFKLIE YL  HPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 7. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 214.1 bits 835,  Expect = 1e-57
 Identities = 126/159 79%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 214.1 bits 835,  Expect = 1e-57
 Identities = 126/159 79%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 9. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 213.1 bits 831,  Expect = 3e-57
 Identities = 125/159 78%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKL+ASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 212.9 bits 830,  Expect = 3e-57
 Identities = 125/159 78%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF  FVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 212.6 bits 829,  Expect = 4e-57
 Identities = 125/158 79%, Positives = 141/158 89%, Gaps = 0/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GV+TYE+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHYH 121
            GS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            TKGDVEI EEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 12. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 212.6 bits 829,  Expect = 4e-57
 Identities = 125/159 78%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GT KKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 212.6 bits 829,  Expect = 4e-57
 Identities = 125/159 78%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKA  LFKLIE++L  HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 212.1 bits 827,  Expect = 6e-57
 Identities = 125/159 78%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+ID VD+ N+ Y Y++IEGDA+++TIEK+SYETKLVASGSGS+IKS SHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHV AGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 211.2 bits 823,  Expect = 1e-56
 Identities = 123/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 16. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 210.7 bits 821,  Expect = 2e-56
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG++T+E+EFTS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHR+D +D+ ++ Y Y++IEGDA+++TIEKISYE KLVASGSGS IKS SHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGD+EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 209.9 bits 818,  Expect = 3e-56
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 209.9 bits 818,  Expect = 3e-56
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 19. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 209.7 bits 817,  Expect = 3e-56
 Identities = 123/159 77%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 20. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 209.7 bits 817,  Expect = 3e-56
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 21. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 209.7 bits 817,  Expect = 3e-56
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIE ISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 22. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 208.4 bits 812,  Expect = 7e-56
 Identities = 122/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVK GKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 23. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 207.9 bits 810,  Expect = 1e-55
 Identities = 126/159 79%, Positives = 144/159 90%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG+FTY  E TSVIPP RLF A+VL+AD LIPKIAPQ+VKSAEI+EGDGGVGTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EGS YSYVKH+IDG+DK+NFVY YS++EGDA+S+ +EKISYE KLVAS  G SVIKSTS+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEE VKAGKEKA+ LFKLIENYL+ +PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 24. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 207.7 bits 809,  Expect = 1e-55
 Identities = 119/159 74%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE+EFTSVIPP +LF AF+LDADNLIPK+AP AVK  EILEGDGGVGTIKK+ FG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y+YVKHR+DG+DK+N+ Y Y++IEGDA+S+ IE I+Y+ KLVAS   GS++K+TSH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEE+VKAGKEKA+ LFKL+E YLL +PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 25. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 207.2 bits 807,  Expect = 2e-55
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+E+TS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKG++EIKEEHVKAGK KA  LFKLIE+YL  HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 26. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 205.4 bits 800,  Expect = 6e-55
 Identities = 118/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIP  RLF AF+LD DNLIPKIAPQA+KS +I+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 27. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 205.4 bits 800,  Expect = 6e-55
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YH KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 28. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 205.4 bits 800,  Expect = 6e-55
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+EFTSVIP  RLF AF+LD DNLIPKIAPQA+KS EI+EGDGGVGTIKK+ FG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK+R++G+DK+NF Y YS+IEGD +S+ +EKI+YETKL+AS   GS+IK+TSH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            Y  KGDVEIKEEHVKAGKEKAS LFKL+E YLL H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 29. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 204.9 bits 798,  Expect = 8e-55
 Identities = 122/159 76%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV++  G++IK+TS Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 204.9 bits 798,  Expect = 8e-55
 Identities = 119/159 74%, Positives = 138/159 86%, Gaps = 0/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+T+E+EFTS IPP+RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSG+ IKS SHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            H KG++EIKEEHVK GKEK   LFKLIE+YL  HPDAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 31. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 203.9 bits 794,  Expect = 2e-54
 Identities = 122/159 76%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYE+E TSVIPPARLF AFVLDADNLIPK+ PQAVKS+EI+EG+GG GTIKKINFG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
            EGS Y YVKHR D +D+ NF Y YSVIEGDA+++ IEKISYETK+VAS   GS++KS SH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YH+KGD EIKEE VK GKEKAS LFK +E YLL HPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 32. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 203.0 bits 790,  Expect = 3e-54
 Identities = 124/159 77%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G+VIK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 33. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 202.5 bits 788,  Expect = 5e-54
 Identities = 122/159 76%, Positives = 135/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 34. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 200.5 bits 780,  Expect = 2e-53
 Identities = 122/159 76%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+TYE+EFTS IP  +LF AFVLDADNLIPKIAPQAVK AEILEGDGG GTIKKI FG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DK N  Y YS+IEGDA+SE IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEEHVKAGKEKA+HLFKLIE YL +HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 35. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 200.2 bits 779,  Expect = 2e-53
 Identities = 121/159 76%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG +TYE+EFTS IP  +LF AFVLDADNLIPKIAPQA+K AEILEGDGG GTIKKI FG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            EGS Y YVKH+I  +DKEN  Y YS+IEGDA+S+ IEKI YETKLV A   G++IK+TS 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGDVEIKEEHVKAGKEKASHLFKLIE YL +HP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 190.0 bits 738,  Expect = 3e-50
 Identities = 113/159 71%, Positives = 133/159 83%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E+E TS IPP RLF AFVLDADNLIPK+AP+A+KSAEI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVKHRID +D+ NF Y YSVIEGD ++E +EKISYE K+VAS   GS++K+TS 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ EIKEE V AGKEKA+ LFK +E YLL H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 189.8 bits 737,  Expect = 3e-50
 Identities = 114/159 71%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESE T+VI PARLF AFVLDADNLIPK+APQA+KS+EI+EG GG GTIKKI FG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS ++YVKHRID +D  NF Y  ++IEGDAISET+EKI+YE KLVAS   GS++KSTS 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD EIKE+++KAGKE+AS +FK +E YLL +P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 181.8 bits 705,  Expect = 8e-48
 Identities = 105/159 66%, Positives = 134/159 84%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIPPARLF  FVLD+DNLIPK+AP+A+KS EI+EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASG-SGSVIKSTSH 119
            EGS ++Y+K++++ +D+ NF Y+YSVIEGDA+S+ +EKI+YE K+VAS   GS++KS S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHT GD E+K+E++KAGKEKAS LFK +E YLL H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 178.1 bits 690,  Expect = 1e-46
 Identities = 103/159 64%, Positives = 127/159 79%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVI PARLF +FVLDADNLIPK+AP+ V SAE +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + Y+KHR+D +D  NF Y YS+IEG  + +T+EKISYE K+VA+ G GS++K TS 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD+ + EE +KAGKEK + LFK +ENYL+ HP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 177.0 bits 685,  Expect = 2e-46
 Identities = 102/137 74%, Positives = 121/137 88%, Gaps = 0/137 0%
Query  10   FTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVK 69
            +TSVIPP +LF AFVLDADNLIPKIAPQAVKS EI+EGDGGVGT+KKI++GEG+ +SYVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHYHTKGDVEIK 129
            H+IDG+DK NFVY YS+ EGDA+ + IEKISYE KLVASG GS+IK+TSHYH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKASHLFKL 146
            EE+VK GKE+A+ LFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 41. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 177.1 bits 686,  Expect = 2e-46
 Identities = 103/158 65%, Positives = 127/158 80%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS++KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 42. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 175.6 bits 680,  Expect = 6e-46
 Identities = 100/159 62%, Positives = 132/159 83%, Gaps = 2/159 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFTYESEFTS I PARLF AFVLD DNL+PKIAPQAV+  EILEG+GGVGTIKKI FG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAI-SETIEKISYETKLVASGSG-SVIKSTS 118
            +G  + YVKH+I+ +DKE++ Y YS+IEGDA+    +EKI++E+KLVASG G +VIK+ S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
             Y++ GD ++ EE VK G+++A++++K +E YL +HP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 43. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 174.1 bits 674,  Expect = 2e-45
 Identities = 102/158 64%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 44. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 173.4 bits 671,  Expect = 3e-45
 Identities = 101/158 63%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ   SAE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EG+ + Y+KH+++ +D  NF Y YS+IEG  +  T+EKI YE K+ A+  G GS++K TS
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 45. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 173.4 bits 671,  Expect = 3e-45
 Identities = 101/158 63%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF+YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 46. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 172.7 bits 668,  Expect = 4e-45
 Identities = 101/158 63%, Positives = 121/158 76%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIPPARLF +FVLDADNLIPK+APQ    AE LEG+GG GTIKKI F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS--GSGSVIKSTS 118
            EGS + Y+KH+++ +D  NF Y YS+IEG  +  T+EKISYE K+ A+  G GS++K TS
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
             YHTKG+  I EE +KAGKEKA+ LFK +E YLL HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 47. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 171.2 bits 662,  Expect = 1e-44
 Identities = 99/158 62%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV  YESE  SVIPPARLF AFVLD+DNLIPK+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF + +SVIEGDA+ + +E +S ETK+VAS   GS++KST  
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 48. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 167.9 bits 649,  Expect = 1e-43
 Identities = 100/159 62%, Positives = 123/159 77%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEKA  L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 166.7 bits 644,  Expect = 3e-43
 Identities = 99/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 166.2 bits 642,  Expect = 4e-43
 Identities = 98/158 62%, Positives = 124/158 78%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   + KHRID +D ENF Y +SVIEGDA+ + +E +S ETK+VAS   GS+ KSTS 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            Y+TKGD ++ +E ++ GKEKAS +FK +E YL+ HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 165.7 bits 640,  Expect = 5e-43
 Identities = 99/158 62%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YESE TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E KLVA+   GS++K ++ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 52. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 165.2 bits 638,  Expect = 8e-43
 Identities = 99/159 62%, Positives = 122/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNLIPK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E KLVA+   GS+++ ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 163.7 bits 632,  Expect = 2e-42
 Identities = 97/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 163.7 bits 632,  Expect = 2e-42
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+  EH+K GKEK   LF+ +E YLL H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 163.5 bits 631,  Expect = 3e-42
 Identities = 97/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 56. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 163.0 bits 629,  Expect = 4e-42
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 57. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 162.7 bits 628,  Expect = 4e-42
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 162.7 bits 628,  Expect = 4e-42
 Identities = 96/159 60%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+L+ D LIPK+APQA+ S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K EH+KA KEK   L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 59. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 162.7 bits 628,  Expect = 4e-42
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 60. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 162.5 bits 627,  Expect = 5e-42
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 162.2 bits 626,  Expect = 6e-42
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+   GS++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 161.7 bits 624,  Expect = 9e-42
 Identities = 97/159 61%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YESE TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 161.7 bits 624,  Expect = 9e-42
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 161.5 bits 623,  Expect = 1e-41
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 161.0 bits 621,  Expect = 1e-41
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIP ARLF AF+LD DNL+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 160.5 bits 619,  Expect = 2e-41
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+   GS++K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 160.2 bits 618,  Expect = 2e-41
 Identities = 97/158 61%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV+ YES+ TSVIPPARLF AFVLD+DNLI K+ P+AVKS EI+EG+GG GTIKK  FG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S   Y KHRID +D EN  Y +SVIEG+A+++ I  IS E K+VAS   GS++KST+ 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            Y+TKG  ++KEE+++A  EK + LFK +E YLL HPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 68. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 160.2 bits 618,  Expect = 2e-41
 Identities = 95/159 59%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            EG  + YVK R+D V  +NF Y YSVIEG  I +T+EKIS E K+VA+  G S++K ++ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+K E++KA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 160.0 bits 617,  Expect = 3e-41
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 159.7 bits 616,  Expect = 3e-41
 Identities = 94/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP AR+F AF+LD D L+PK+APQA+ S E +EG+GG GTIKKINF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 159.7 bits 616,  Expect = 3e-41
 Identities = 95/159 59%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 159.5 bits 615,  Expect = 4e-41
 Identities = 94/158 59%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            G  + YVK R+D VD  NF Y YS+IEG  + +T+EKIS E K+VA+   GS++K ++ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGD E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 73. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 159.3 bits 614,  Expect = 5e-41
 Identities = 96/157 61%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+ES+ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S + Y KHRID +D EN  Y +SVIEGDA+++ +  +S E K+VAS   GS+ KST+ 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            Y+TKGD ++KEE+++A  EK + L K +E YLL HPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 74. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 159.3 bits 614,  Expect = 5e-41
 Identities = 95/157 60%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG GTIKKI FG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E S + Y KHRID +D EN  Y +SVIEGDA++  +E +S E K VAS   GS++KST+ 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            Y+TKGD ++KEE+++A  EKA+ L+K +E YL+ HPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 75. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 158.5 bits 611,  Expect = 8e-41
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 158.5 bits 611,  Expect = 8e-41
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG  + YVK R+D VD  NF Y YSVIEG  I + +EKIS E K+VA+  G  V+K ++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 158.0 bits 609,  Expect = 1e-40
 Identities = 94/159 59%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD +NLIPK+APQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 78. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 157.8 bits 608,  Expect = 1e-40
 Identities = 95/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S E +EG+GG GTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
             G  + YVK R+D VD  NF Y YSVIEG  I +T+EKIS E K+VA+  G  V+K ++ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +E+YLL H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 157.0 bits 605,  Expect = 2e-40
 Identities = 92/159 57%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VA+   GS++K ++ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +HTKGD EI  E++K  KEKA  L+K +E+YLL H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 80. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 155.5 bits 599,  Expect = 6e-40
 Identities = 90/159 56%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 81. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 155.3 bits 598,  Expect = 7e-40
 Identities = 91/158 57%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF AF+LD D L+PK+AP+AV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + YVK R+D VD+ NF Y +SVIEG A+ + +EK+  E K+VA+   GS++K ++ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            HTKGD EI  E++K  KEKA  L+K +E+YLL H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 82. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 154.8 bits 596,  Expect = 1e-39
 Identities = 92/159 57%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS   YVK R++ VD  NF Y Y+VIEG  + + +EKI  E K+VA+   GS++K TS 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            YHTKGD E+  EH+K GKE+   L+K +E YLL H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 154.3 bits 594,  Expect = 1e-39
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 154.0 bits 593,  Expect = 2e-39
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 153.8 bits 592,  Expect = 2e-39
 Identities = 89/158 56%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+ +E K+VA+ G GS++K +S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 86. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 153.8 bits 592,  Expect = 2e-39
 Identities = 90/159 56%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVIP ARLF ++VLD D LIPK+APQA+ S E +EG+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS++K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 87. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 153.3 bits 590,  Expect = 3e-39
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 88. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 151.8 bits 584,  Expect = 8e-39
 Identities = 87/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GSV+K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 151.5 bits 583,  Expect = 1e-38
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 151.5 bits 583,  Expect = 1e-38
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 151.4 bits 582,  Expect = 1e-38
 Identities = 90/149 60%, Positives = 114/149 76%, Gaps = 1/149 0%
Query  4    FTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            F YESE TSVIP ARLF AF+L+ DNLIPK+APQA+ S E +EG+GG GTIKKI F EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHYHT 122
             + YVK R+D VD  NF Y YS+IEG A+ +T+EKI  E K+VA+   GS++K ++ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            KGD E+K EH+KA KEK   L++ +E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 92. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 151.1 bits 581,  Expect = 1e-38
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 150.8 bits 580,  Expect = 2e-38
 Identities = 86/159 54%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 149.8 bits 576,  Expect = 3e-38
 Identities = 86/158 54%, Positives = 114/158 72%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E TSVIP ARLF AF+LD + LIPK++PQAV S E +EG+GG GTIKKI F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS   YVK R++ +D  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 95. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 149.8 bits 576,  Expect = 3e-38
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+   E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 149.6 bits 575,  Expect = 4e-38
 Identities = 82/156 52%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS +  VK+R+D +DK+N+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPD 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YLL +PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 97. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 149.6 bits 575,  Expect = 4e-38
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EG  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 98. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 147.8 bits 568,  Expect = 1e-37
 Identities = 88/159 55%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE E  SVI  ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I FG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS Y YVK R+D VD  NF Y Y+VIEGD + + +EK+  E K+VA+ G GS +K +S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD EI  E +K  KE A  L++ +E YLL H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 99. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 147.3 bits 566,  Expect = 2e-37
 Identities = 84/159 52%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E K+VA+ G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 100. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 147.1 bits 565,  Expect = 2e-37
 Identities = 84/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            GS + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 101. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 146.1 bits 561,  Expect = 4e-37
 Identities = 86/149 57%, Positives = 111/149 74%, Gaps = 1/149 0%
Query  4    FTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
            F YE+E TSVIP ARLF AF+LD DNL PK+APQA+ S + +EG+GG GTIKKINF EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSHYHT 122
             + YVK R+D VD  NF Y YSVIEG  + +T+EKIS E K+VA+  G  ++K ++ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            KG+ E+K E+VKA KE    L++ +E+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 102. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 144.8 bits 556,  Expect = 1e-36
 Identities = 82/159 51%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVF YE+E  SV+P ARLF ++VLD D LIPK+APQA+ S E + G+GG GTIK I F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            EGS + +VK R+D VD  NF + Y+VIEGD + + +EK+S E  +VA+ G GS++K +  
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            +H KGD E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 143.9 bits 552,  Expect = 2e-36
 Identities = 82/158 51%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVF YE+E  SVIP ARLF ++VLD D LIPK+APQ + S E + G+GG GTIK I F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSHY 120
            G  + +VK R+D VD  NF Y Y+VIEGD + + +EK+S+E K+VA+ G GS++K +S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            H KG  E+  E +K  KE A  L++ +E+YLL H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 104. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 142.1 bits 545,  Expect = 7e-36
 Identities = 85/155 54%, Positives = 107/155 69%, Gaps = 2/155 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  TY+ E  S I   ++F AFVLD D +IPK  P+A+   + LEGDGGVGTIK   FG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
            EGS +  VKHRIDG+DKENF Y YS+IEG A+ +  E ISY  K+VA+  G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPD 156
            Y  K D ++ EE +KAGKE+AS +FK +E YLL +PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 105. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 134.9 bits 516,  Expect = 1e-33
 Identities = 80/158 50%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
            EG    Y+KH+I  +D +N+V KYS+IEGD + + +E I+Y+ K+ A+G G  + K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            YHTKGD  + EE    GK KA  LFK IE YLL +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 106. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 132.2 bits 505,  Expect = 7e-33
 Identities = 78/158 49%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            YHTKGD  + EE    G+E+  ++ K +E YLL +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 107. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 129.7 bits 495,  Expect = 4e-32
 Identities = 83/157 52%, Positives = 107/157 68%, Gaps = 3/157 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E E  S + PA L+ A+V DADN+IPK A  + KS E +EG+GG GTIKKI F 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YSV+ G A+ +T EKI++++KLVA    GS  K T  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159
            Y TKGD E  ++ +K GK KA  LFK IE YLL HPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 108. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 128.0 bits 488,  Expect = 1e-31
 Identities = 78/156 50%, Positives = 106/156 67%, Gaps = 3/156 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E E TS +PPA+L+NA + DAD++ PKI    VKS EI+EG+GG GTIKK+   
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
            E     ++ H+++ +D+ N+ Y YSV+ G A+  T EKI++ETKLV     GS+ K T  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158
            YHTKGD +  EE +K GK K   LF+ IE Y+L +P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 125.5 bits 478,  Expect = 7e-31
 Identities = 74/155 47%, Positives = 104/155 67%, Gaps = 1/155 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155
            YH+KGD    E+ +KAGK K+  LFK +E YLL +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 123.8 bits 471,  Expect = 2e-30
 Identities = 73/154 47%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
            GVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155
            H+KGD    E+ +KAGK K+  LFK +E YLL +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 122.3 bits 465,  Expect = 6e-30
 Identities = 75/154 48%, Positives = 106/154 68%, Gaps = 2/154 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VFT+E + TS + PA L+ A+V DAD ++PK A  + KS EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSH 119
            E     +V H+I+ +D+ N+ Y YS++ G A+ +T EKIS ++KL      GSV+K +  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155
            YH+KGD    E+ +KAGK K+  LFK+IE YLL +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 120.4 bits 458,  Expect = 3e-29
 Identities = 71/145 48%, Positives = 99/145 68%, Gaps = 1/145 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV TY  E T+ I P RLF A+VLD DNL+PK+  Q VK+ E +EGDGGVG+IK++NF 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            EG    Y+KH+I  +D +N+  KYS+IEGD + E +E I+Y+ K+ A+ +G  V K+T+ 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFK 145
            YHTKGD  + EE    G+ +    F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 113. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 119.8 bits 455,  Expect = 3e-29
 Identities = 76/153 49%, Positives = 108/153 70%, Gaps = 4/153 2%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            M VFT++ + TS + PA L+NA+  DADN+IPK A  + +S EI+EG+GG GTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGS--GSVIKSTS 118
            E     +V H+I+ VD+ N+ Y YS++ G A+ +T EKI+ +TK ++ G+  GS+IK T 
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTK-ISDGADGGSLIKLTI 118
Query  119  HYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155
             YH KGD    E+ +KAGK K+  LFK +E YLL +P
Sbjct  119  SYHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 119.1 bits 452,  Expect = 6e-29
 Identities = 70/151 46%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+E E TS +PPA+LF A V+D D L PK+ P A++S EI+EG+GG GT+KK+   
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E    SYV H+ID +D+  + Y Y++  G    E +EK+S++TKL A+  GS IK +  +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            HTKGD  + +E  +  K+K+  +FK IE Y+L
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVL 151

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 114.3 bits 433,  Expect = 2e-27
 Identities = 65/152 42%, Positives = 99/152 65%, Gaps = 1/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E   TS +P A+LF A+ LD D L+P++ P A+K  EILEGDGGVGT+K + +G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGS-VIKSTSH 119
            + S Y  +K++ID +DKE F + YS+I+GD +   I+ I+    +V +  G     ST+ 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            ++TKGD  + EE++K   ++ + +FK +E YLL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLL 153

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 112.1 bits 424,  Expect = 7e-27
 Identities = 61/152 40%, Positives = 99/152 65%, Gaps = 0/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV   E E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT++ +++G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + E +E +  +  +V +  G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +TKGD  + E+ VK   EK++  FK +E YLL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYLL 152

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 111.8 bits 423,  Expect = 9e-27
 Identities = 60/152 39%, Positives = 98/152 64%, Gaps = 0/152 0%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV     E  S +   +++  F+LD D + PK+ PQ +KS EILEGDGGVGT+K +++G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
            E + Y+ +K+++D +DK  + Y Y+ I GD + + +E +  E  +V +  G ++K+T+ Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +TKGD  + E+ +K   EK++  FK +E YLL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYLL 152

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 109.1 bits 412,  Expect = 6e-26
 Identities = 61/151 40%, Positives = 92/151 60%, Gaps = 1/151 0%
Query  7    ESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYS 66
            E E TS + P+ +F AFV+D D + PK  P+  KS + +EGDGGVGTIK I + +G  ++
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSHYHTKGD 125
              KH++D +D  NF   Y++ EGD +   IE  ++  K++ S  G SV K +  +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  VEIKEEHVKAGKEKASHLFKLIENYLLEHPDA 157
             ++ +E+V   KE     FK IE Y++ HP+A
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 107.4 bits 405,  Expect = 2e-25
 Identities = 67/151 44%, Positives = 98/151 64%, Gaps = 2/151 1%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MGV T+  E+TS +   ++F  FV+D D ++PK AP A KS EI +GDGG GT+K I + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSG-SVIKSTSH 119
            +G   + +  RIDGV+KE + + YSVI+GD +   IE I     LV +  G S+ K+T+ 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            +HTKGD  + EE++K   E+ + LFK +E YL+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLI 152

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 100.9 bits 379,  Expect = 2e-23
 Identities = 64/149 42%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 100.9 bits 379,  Expect = 2e-23
 Identities = 65/149 43%, Positives = 96/149 64%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET LV    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K   E+ + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYLI 152

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 100.2 bits 376,  Expect = 3e-23
 Identities = 65/149 43%, Positives = 95/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK AP A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET LV    +  GS+ K+T
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 100.1 bits 376,  Expect = 3e-23
 Identities = 64/149 42%, Positives = 95/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F   VLD D +IPK AP A KS ++ +GDGG GT++ I + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD + E IE I  ET +V    +  GS+ K+T
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESI--ETHMVVVPTADGGSITKTT 131
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  132  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 166

Sequence Alignment: 124. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 97.1 bits 362,  Expect = 2e-22
 Identities = 78/99 78%, Positives = 87/99 87%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKENFV 81
            AFVLDADNLIPK                      KI FGEGS Y YVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHYHTKGDVEIKEEHVKAGKEKA 140
                 +EGDA+S+T+EKI YETKLV A  S ++IK+TS YHTKGDVEIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  SHLFKLIENYLLEHPDAYN 159
            +HLFKLIE YL +HP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 96.5 bits 361,  Expect = 4e-22
 Identities = 63/149 42%, Positives = 94/149 63%, Gaps = 6/149 4%
Query  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
            MG  ++  E TS +   ++F+  VLD D +IPK A  A KS E+ +GDGG GT++ I + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVA---SGSGSVIKST 117
            EGS  + +  R D V+KE + Y  +VI+GD +   IE I  ET +V    +  GS+ K+T
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESI--ETHMVVVPTADGGSITKTT 117
Query  118  SHYHTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152
            + +HTKGD  + EE++K    + + LFK IE YL+
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLI 152

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 63.7 bits 225,  Expect = 9e-13
 Identities = 34/49 69%, Positives = 42/49 85%, Gaps = 0/49 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50
            GVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 50.0 bits 174,  Expect = 4e-08
 Identities = 40/126 31%, Positives = 64/126 50%, Gaps = 6/126 4%
Query  24   VLDAD--NLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKENFV 81
            VL  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    + SY +  I   D+ +  
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YKYSVIEGDAISETIE--KISYETKLVASGSGSVIKSTSHYHTKGDVEIKEEHVKAGKEK 139
                VIEG  +++ +   K +++   +      V    S+ H   D+E K    K  +  
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
Query  140  ASHLFKLIENYL 151
              +L +L E YL
Sbjct  140  LMYLRRL-ERYL 150

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 39.8 bits 126,  Expect = 7e-06
 Identities = 20/24 83%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  2    GVFTYESEFTSVIPPARLFNAFVL 25
            GVFT+ES+ TSVIPPARLF AFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.