The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV
EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE
YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA
Sequence Info Allergen Name Length Opt Bits Score E Value
NP_001275580 Sola l 4.0201 160 1037 268.0 8.8e-74
AHC08073 Sola l 4.0101 160 862 223.9 1.6e-60
CAA75803 Lyc e 4.0101 178 775 202.0 7.4e-54
B6CQS9 Pru du 1.0101 160 574 151.4 1.1e-38
APD76154 Jug r 5.0101 160 560 147.9 1.3e-37
ACJ23864 Fag s 1.0101 160 553 146.1 4.3e-37
O50001 Pru ar 1 160 550 145.3 7.3e-37
CAD10374 Cas s 1 160 541 143.1 3.5e-36
CAM31908 Act c 8.0101 159 530 140.3 2.4e-35
CAA96549 Cor a 1.0301 160 530 140.3 2.4e-35
CAA54696.1 Bet v 1.0301 160 527 139.6 4.1e-35
Q2I6V8 Pru p 1.0101 160 518 137.3 2e-34
ABZ81046 Que a 1.0301 160 518 137.3 2e-34
ABZ81047 Que a 1.0401 160 517 137.0 2.3e-34
AAO25113 Mal d 1.0304 159 516 136.8 2.8e-34
O24248 Pru av 1 160 513 136.0 4.7e-34
AAG40329 Cor a 1.0402 161 512 135.8 5.6e-34
Q3T923 Fra a 1 160 511 135.5 6.6e-34
AAG40331 Cor a 1.0404 161 511 135.5 6.7e-34
CAA96535 Mal d 1.0401 160 510 135.3 7.9e-34
AAD48405 Cor a 1.0401 161 510 135.3 8e-34
Q256S7 Fra a 1 160 509 135.0 9.4e-34
AAG40330 Cor a 1.0403 161 509 135.0 9.5e-34
AAK13027 Mal d 1.0302 159 507 134.5 1.3e-33
AFN42528 Can s 5.0101 161 507 134.5 1.3e-33
AAD13683 Mal d 1.0206 159 504 133.8 2.2e-33
AUH28179 Que m 1.0101 160 503 133.5 2.7e-33
Q256S2 Fra a 1 160 502 133.3 3.2e-33
Q256S6 Fra a 1 160 500 132.8 4.5e-33
CAA96534 Mal d 1.0301 159 497 132.0 7.6e-33
AAD26548 Mal d 1.0204 159 497 132.0 7.6e-33
AAB01362 Mal d 1.0201 159 496 131.8 9e-33
AAD26545 Mal d 1.0202 159 496 131.8 9e-33
CAA96536 Mal d 1.0402 160 495 131.5 1.1e-32
CAA96537 Mal d 1.0403 160 495 131.5 1.1e-32
AAD26558 Mal d 1.0205 159 494 131.2 1.3e-32
AAK13028 Mal d 1.0303 159 491 130.5 2.2e-32
Q256S4 Fra a 1 159 490 130.2 2.6e-32
AAD26547 Mal d 1.0203 159 490 130.2 2.6e-32
AAK13030 Mal d 1.0207 159 490 130.2 2.6e-32
CAA96548 Cor a 1.0201 160 490 130.2 2.6e-32
AAD26555 Mal d 1.0107 159 484 128.7 7.3e-32
AAK13029 Mal d 1.0109 159 483 128.5 8.7e-32
CAA58646 Mal d 1.0101 159 483 128.5 8.7e-32
QOL10866 Que ac 1.0101 159 483 128.5 8.7e-32
CAB02209 Car b 1.0106 160 483 128.5 8.8e-32
CAD32318 Mal d 1.0208 158 481 128.0 1.2e-31
QGS84240 Que i 1.0101 159 480 127.7 1.5e-31
AAD26546 Mal d 1.0103 159 480 127.7 1.5e-31
CAB02216 Car b 1.0301 161 480 127.7 1.5e-31
CAB02217 Car b 1.0302 161 480 127.7 1.5e-31
AAD26554 Mal d 1.0106 159 479 127.5 1.8e-31
AAD29671 Mal d 1.0108 159 478 127.2 2.1e-31
AAD26553 Mal d 1.0105 159 478 127.2 2.1e-31
Q39427 Bet v 1.0205 160 478 127.2 2.1e-31
ABZ81045 Que a 1.0201 159 477 127.0 2.5e-31
CAB02208 Car b 1.0105 160 477 127.0 2.5e-31
AAD26552 Mal d 1.0104 159 476 126.7 3e-31
O65200 Pyr c 1 159 476 126.7 3e-31
CAB02213 Car b 1.0107 160 475 126.5 3.6e-31
CAA54482 Bet v 1.0102 160 475 126.5 3.6e-31
CAA88833 Mal d 1.0102 159 474 126.2 4.2e-31
AAB24432 Aln g 1 160 474 126.2 4.2e-31
P43186 Bet v 1.0204 160 473 126.0 5e-31
CAA54489 Bet v 1.0107 160 473 126.0 5e-31
ABZ81041 Car b 1.0110 160 472 125.7 6e-31
ABZ81043 Car b 1.0112 160 471 125.5 7.2e-31
CAA54485 Bet v 1.0105 160 471 125.5 7.2e-31
P38950 Car b 1 159 470 125.2 8.5e-31
ABZ81040 Car b 1.0109 160 470 125.2 8.5e-31
CAA04828.1 Bet v 1.0206 159 468 124.7 1.2e-30
P43184 Bet v 1.0203 160 468 124.7 1.2e-30
CAA43637 Pha v 1 156 467 124.5 1.4e-30
P38948 Aln g 1 159 467 124.4 1.4e-30
ABZ81044 Car b 1.0113 160 467 124.4 1.4e-30
CAA54421 Bet v 1.0201 160 467 124.4 1.4e-30
ABZ81042 Car b 1.0111 160 466 124.2 1.7e-30
CAA07323.1 Bet v 1.0117 160 466 124.2 1.7e-30
CAA50325 Cor a 1.0103 160 466 124.2 1.7e-30
CAM31909 Act d 8.0101 157 465 124.0 2e-30
ADK39021 Ost c 1.0101 160 465 123.9 2e-30
CAB02155 Bet v 1.0108 160 465 123.9 2e-30
CAB02215 Car b 1.0108 160 465 123.9 2e-30
CAB02206 Car b 1.0103 160 465 123.9 2e-30
CAA43636 Pha v 1 155 464 123.7 2.3e-30
CAB02207 Car b 1.0104 160 464 123.7 2.4e-30
CAB02160 Bet v 1.0113 160 464 123.7 2.4e-30
CAB02157 Bet v 1.0110 160 464 123.7 2.4e-30
CAA50327 Cor a 1.0101 160 461 122.9 4.1e-30
P25985 Pha v 1 155 460 122.7 4.7e-30
CAA54481 Bet v 1.0202 160 459 122.4 5.8e-30
CAA07329.1 Bet v 1.0118 160 458 122.2 6.9e-30
CAA33887 Bet v 1.0101 160 457 121.9 8.2e-30
CAB02159 Bet v 1.0112 160 457 121.9 8.2e-30
CAB02158 Bet v 1.0111 160 457 121.9 8.2e-30
CAB02156 Bet v 1.0109 160 456 121.7 9.8e-30
CAB02161 Bet v 1.0114 160 455 121.4 1.2e-29
CAA42646 Gly m 4 158 454 121.2 1.4e-29
Q08407 Cor a 1 159 454 121.2 1.4e-29
CAA50328 Cor a 1.0102 160 454 121.2 1.4e-29
CAA47357 Car b 1.0102 159 453 120.9 1.6e-29
CAA04827.1 Bet v 1.0116 159 452 120.7 2e-29
Q2VU97 Vig r 1.0101 155 448 119.7 3.8e-29
AAQ91847 Ara h 8.0101 157 448 119.7 3.9e-29
CAA54487 Bet v 1.0106 160 447 119.4 4.7e-29
CAA54483 Bet v 1.0103 160 446 119.2 5.6e-29
CAA54484 Bet v 1.0104 160 445 118.9 6.7e-29
CAA96547 Bet v 1.0115 160 443 118.4 9.5e-29
CAA50326 Cor a 1.0104 160 443 118.4 9.5e-29
P38949 Car b 1 159 442 118.2 1.1e-28
ACF75030.1 Bet v 1.0207 150 440 117.7 1.5e-28
ABC41615.1 Bet v 1.0119 150 437 116.9 2.5e-28
Q0Z8U9 Rub i 1.0101 137 434 116.2 3.7e-28
EF436550 Ara h 8.0201 153 415 111.4 1.2e-26
P49372 Api g 1 154 408 109.6 4.1e-26
P92918 Api g 1.0201 159 404 108.6 8.5e-26
CAA67246 Pet c PR10 155 401 107.8 1.4e-25
AAL76932 Dau c 1.0201 154 389 104.8 1.1e-24
AAB92255 Tar o RAP 157 385 103.8 2.3e-24
CAB03715 Dau c 1.0103 154 378 102.1 7.6e-24
CAB06416 Dau c 1.0105 154 377 101.8 9.1e-24
BAA13604 Dau c 1.0102 154 376 101.5 1.1e-23
CAB03716 Dau c 1.0104 154 370 100.0 3.1e-23
AAB01092 Dau c 1.0101 168 365 98.7 8.3e-23
Q5ULZ4 Fra a 1.0101 100 220 62.5 4e-12
P85126 Que a 1.0101 50 175 51.6 3.9e-09
Q9ZWP8 Vig r 6.0101 155 168 49.2 6.4e-08
P85524 Act d 11.0101 150 119 36.8 0.00032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 268.0 bits 1037,  Expect = 9e-74
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA 160
            YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA 160

Sequence Alignment: 2. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 223.9 bits 862,  Expect = 2e-60
 Identities = 130/160 81%, Positives = 147/160 91%, Gaps = 0/160 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGVNT+T+ESTTTI+PTRLFK LVLDFD+LVPKLLS+ VK+ E +EGDGG GSIKQMNFV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EGGPIKYLKHKIHVIDDKNL TKYSLIEGD+LG+KLESI YD+KFEA  +GGCV KTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVYA 160
            YHTKGDHVVSEEEHNVG+ + +++ KA+EAYLLANPSVYA
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVYA 160

Sequence Alignment: 3. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 202.0 bits 775,  Expect = 7e-54
 Identities = 117/146 80%, Positives = 132/146 90%, Gaps = 0/146 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGVNT+T+ESTTTI+PTRLFK LVLDFD+LVPKLLS+ VK+ E +EGDGG GSIKQMNFV
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EGGPIKYLKHKIHVIDDKNL TKYSLIEGD+LG+KLESI YD+KFEA  +GGCV KTTTE
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFK 146
            YHTKGDHVVSEEEHNVG+ +  + F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 4. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 151.4 bits 574,  Expect = 1e-38
 Identities = 87/159 54%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG+ T+T EST+ I P RLFK LVL+ D+L+PK+  + VKS EIVEGDGG G+IK+++F 
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  +D  N+V  YSL+EGD L DK+E I+Y++K+ A+ DGG V K+T+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE+   GK KA  LFK IE YL+ANP  Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 5. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 147.9 bits 560,  Expect = 1e-37
 Identities = 83/159 52%, Positives = 114/159 71%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  EST+ I P RLFK +VLD D+L+PK++ + VKS EI+EG+GG G+IK++NF 
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+KH+   ID+ N+   YS+IEGD L DK+E I+Y+ K  A+ +GG + K+ + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YH+KGDH + EE+   GK KA  LFKA+E YLLA+P  Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 6. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 146.1 bits 553,  Expect = 4e-37
 Identities = 81/159 50%, Positives = 115/159 72%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E+TT I P RLFK +VLD D+L+PK+  + +KS EI+EG GG G+IK++ F 
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ N+    +LIEGD + + LE IAY++K+ A+ DGG + K+T++
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH + E++   GK +A  +FKA+EAYLLANP+ Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 7. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 145.3 bits 550,  Expect = 7e-37
 Identities = 84/159 52%, Positives = 110/159 69%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P +LFK ++LD D+L+PK+    VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH++  ID  NL   Y+LIEGD L D +E+IAYD+K+ A+ DGG + KTT+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE+   GK KA  LFK +EAYLLANP  Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 8. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 143.1 bits 541,  Expect = 4e-36
 Identities = 83/159 52%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T  +E T+ I P RLFK +VLD D+L+PKL  H +KS EI+EG+GG G+IK++ F 
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+KH+I  ID  N+   YS+IEGDV+ + LE I+Y++K  A+ DGG + K T++
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG++ + EE+   GK KA  LFKA+EAYLLA+   Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 9. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 140.3 bits 530,  Expect = 2e-35
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 0/156 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E  + + P +L+K ++LD D+LVPK+L H +K ++I+EGDG AG+IK++ F 
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   K +K+++  ID  NL   Y++IEGDVL +K+ESI+Y +K  A  DGG +CK  + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            Y TKGD  VSEEE  +GK KA ++FKA+EAYLLANP
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 10. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 140.3 bits 530,  Expect = 2e-35
 Identities = 79/159 49%, Positives = 110/159 69%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I P RLFK +VLD D+L+PK+    +KSIEI+EG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P  Y+K+K+  ID  N+  +YS+IEGD L DKLE I Y++K  A+  GG + K+ ++
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHT GDH + +E+   GK KA  LFKA+E YLLA+   Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 11. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 139.6 bits 527,  Expect = 4e-35
 Identities = 80/159 50%, Positives = 110/159 69%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ IAP RLFK +VLD D+L+PK+   +V S E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+KH++  ID  N+   YS+IEG  LGD LE I+Y++K  AA  GG + K T++
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  ++EEE   GK K   LFKA+E YL+A+P+ Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 12. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 137.3 bits 518,  Expect = 2e-34
 Identities = 82/159 51%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P RLFK +VLD D+LVPK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  ID +N    Y+LIEGD LGD LE I+Y+ K+ A+  GG + K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA +LFK IE YL  +P  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 13. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 137.3 bits 518,  Expect = 2e-34
 Identities = 77/159 48%, Positives = 117/159 73%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E  + I P RLFK +VLD D+L+PK++ + +KS EI+EG+GG G+IK++ F 
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG  +K+ KH+I VID +N+   +S+IEGD L DKLE+++ + K  A+ DGG + K+T++
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            Y+TKGD  +++E    GK KA ++FKA+EAYL+A+P +Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 14. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 137.0 bits 517,  Expect = 2e-34
 Identities = 82/157 52%, Positives = 118/157 75%, Gaps = 4/157 2%
Query  1    MGVNTFTHES--TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMN 58
            MGV  FTHES  T+ IAP RLFK L LD D+L+ K+L + +KS EI+EG+GG G+IK++ 
Sbjct  1    MGV--FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKIT 58
Query  59   FVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTT 118
            F EG  +K+ KH+I VID +N+   +S+IEGD L DKLE+++ + K  A+ DGG + K+T
Sbjct  59   FGEGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKST 118
Query  119  TEYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            ++Y+TKGD  +++E    GK KA  +FKA+EAYL+A+P +Y
Sbjct  119  SKYQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 136.8 bits 516,  Expect = 3e-34
 Identities = 80/158 50%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  +D +N+V KYS+IEGD + + +E I+Y+ K+ A+G G  + K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YLL +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 16. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 136.0 bits 513,  Expect = 5e-34
 Identities = 81/159 50%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P RLFK +VLD D+LVPK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  ID +N    Y+LIEGD LGD LE I+Y+ K+ A+  GG + K+T+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA +LFK IE YL  +P  Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 17. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 135.8 bits 512,  Expect = 6e-34
 Identities = 80/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV ++  E+T+ I P RLFK +VLD D+L+PK+  +     E +EG+GG G+IK++ F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGG-CVCKTTT 119
            EG   KY+KHK+  ID  N+   YS+IEG  LG  LE I+Y++K  AA  GG  + K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +YHTKG+  +SEEE   GK KA  LFKA+EAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 18. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 135.5 bits 511,  Expect = 7e-34
 Identities = 83/159 52%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A  GG V KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 19. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 135.5 bits 511,  Expect = 7e-34
 Identities = 80/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV ++  E+T+ I P RLFK +VLD D+L+PK+  +   S E +EG+GG G+IK++ F 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGG-CVCKTTT 119
            EG   KY+KHK+  ID  N+   YS+IEG  LG  LE I Y++K  AA  GG  + K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +YHTKG+  ++EEE   GK KA  LFKA+EAYLLA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 20. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 135.3 bits 510,  Expect = 8e-34
 Identities = 78/159 49%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + +KS EI+EGDGG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L DKLE I Y+ K+ A+ DGG + KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YH KGD  + EE    GK KA  LFK +EAYLLA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 21. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 135.3 bits 510,  Expect = 8e-34
 Identities = 80/159 50%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I P RLFK +VLD D+L+PK+  +   S E +EG+GG G+IK++ F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGG-CVCKTTT 119
            EG   KY+KHK+  ID  N+   YS+IEG  LG  LE I+Y++K  AA  GG  + K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +YHTKG+  ++EEE   GK KA  LFKA+EAYLLA+P  Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 135.0 bits 509,  Expect = 9e-34
 Identities = 81/159 50%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A  GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 23. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 135.0 bits 509,  Expect = 9e-34
 Identities = 80/159 50%, Positives = 107/159 67%, Gaps = 1/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I P RLFK +VLD D+L+PK+  +     E +EG+GG G+IK++ F 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGG-CVCKTTT 119
            EG   KY+KHK+  ID  N+   YS+IEG  LG  LE I+Y++K  AA  GG  + K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  EYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +YHTKG+  +SEEE   GK KA  LFKA+EAYLLA+P  Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 24. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 134.5 bits 507,  Expect = 1e-33
 Identities = 80/158 50%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  +D  N+V KYS+IEGD + + +E I+Y+ K+ AAG G  + K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVI-KSTSH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YLL +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 25. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 134.5 bits 507,  Expect = 1e-33
 Identities = 78/159 49%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T++IAP RLFK +VLD D+LVPK+  + V+ +EI+EG+GG G+IK++ F 
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVL-GDKLESIAYDVKFEAAGDGGCVCKTTT 119
            +G P KY+KHKI  ID ++L   YS+IEGD L G++LE I ++ K+ A+GDGG V KT +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  EYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +Y++ GD  V+EE+   G+ +A  ++K +EAYL  +P  Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 26. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 133.8 bits 504,  Expect = 2e-33
 Identities = 78/158 49%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFKG+VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 27. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 133.5 bits 503,  Expect = 3e-33
 Identities = 76/159 47%, Positives = 113/159 71%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E  + I P RLFK +VLD D+L+PK++ + +KS EI+EG+GG G+IK++ F 
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG  +K+ KH+I VID +N+   +S+IEGD L DKLE+++ + K  A+ DGG + K+T +
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            Y+TKGD  +++E    GK KA  +FKA+EAYL+A+P  Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 28. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 133.3 bits 502,  Expect = 3e-33
 Identities = 81/159 50%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKIH ID  N    YSLIEGD L + +E I Y+ K+ +A  GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 29. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 132.8 bits 500,  Expect = 5e-33
 Identities = 80/159 50%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  T+ +E T+ I   +LFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A  GG + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 30. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 132.0 bits 497,  Expect = 8e-33
 Identities = 78/158 49%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E T+ I P RLF  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  +D +N+V KYS+IEGD + + +E I+Y+ K+ A+G G  + K+T+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVI-KSTSH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTK D  + EE    GK KA  LFK IE YLLA+   Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 31. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 132.0 bits 497,  Expect = 8e-33
 Identities = 77/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 32. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 131.8 bits 496,  Expect = 9e-33
 Identities = 77/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 33. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 131.8 bits 496,  Expect = 9e-33
 Identities = 77/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 34. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 131.5 bits 495,  Expect = 1e-32
 Identities = 76/159 47%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E T+ I   RLFK ++LD D+L+PK+  + +KS +I+EGDGG G+IK++ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L DKLE I Y+ K+ A+ DGG + KT + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YH KGD  + EE    GK KA  LFK +EAYLLA+   Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 35. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 131.5 bits 495,  Expect = 1e-32
 Identities = 77/159 48%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E T+ I   RLFK ++LD D+L+PK+  + +KS EI+EGDGG G+IK++ F 
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+K++++ ID  N+   YS+IEGD L DKLE I Y+ K+ A+ DGG + KTT+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            Y  KGD  + EE    GK KA  LFK +EAYLLA+   Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 36. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 131.2 bits 494,  Expect = 1e-32
 Identities = 77/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 37. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 130.5 bits 491,  Expect = 2e-32
 Identities = 77/158 48%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+  E T+ I P RL+  +VLD D+L+PK+  + VKS EI+EGDGG G+IK++NF 
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D  N+V +YS+IEGD + + +E I+Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YLL +   Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 38. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 130.2 bits 490,  Expect = 3e-32
 Identities = 81/158 51%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T+ +E T+ I   +LFK +VLD D+L+PK+  + VK  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKIH ID +N    YSLIEGD L D +E I Y+ K+ +A   G + KTT++
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSA-PHGTIIKTTSK 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 39. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 130.2 bits 490,  Expect = 3e-32
 Identities = 76/158 48%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE++L  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 40. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 130.2 bits 490,  Expect = 3e-32
 Identities = 76/158 48%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+ K++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 41. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 130.2 bits 490,  Expect = 3e-32
 Identities = 74/159 46%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  EST+ I   RLFK ++LD ++L+PK+  + V S+E VEG+GG G+IK++ F 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   Y++IEG  +GDK+E I  ++K  AA DGG + K + +
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E    GK K   LF+A+EAYLLA+   Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 42. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 128.7 bits 484,  Expect = 7e-32
 Identities = 75/158 47%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 43. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 128.5 bits 483,  Expect = 9e-32
 Identities = 76/158 48%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE   VGK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 44. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 128.5 bits 483,  Expect = 9e-32
 Identities = 76/158 48%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE   VGK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 45. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 128.5 bits 483,  Expect = 9e-32
 Identities = 76/158 48%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  + T+ I P RLFK +VLD D+L+ K+L H VKS EI+EG+GG G+IK+  F 
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E   +KY KH+I  +D +N    +S+IEG+ L D + SI+ +VKF A+ DGG + K+TT+
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            Y+TKG   + EE+      K   LFKA+EAYLLA+P +Y
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 46. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 128.5 bits 483,  Expect = 9e-32
 Identities = 70/159 44%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLDFD L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 47. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 128.0 bits 481,  Expect = 1e-31
 Identities = 75/157 47%, Positives = 104/157 66%, Gaps = 1/157 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV T+ +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EGDGG G+IK++ F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G    Y+KHKI  +D+ N    Y+LIEGD L D +E ++Y+ K+ A+G G  + K+ + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSII-KSISHY 119
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            HTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 48. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 127.7 bits 480,  Expect = 1e-31
 Identities = 75/158 47%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV+T   + T+ I P RLFK +VLD D+L+PK+L + +KSIE +EG+GG G+IK++ F 
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E    KY KH+I  +D +N    +S+IEGD L D + S++ ++KF A+ DGG + K+TT+
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            Y+TKGD  + EE+      K   L KA+EAYLLA+P +Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 49. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 127.7 bits 480,  Expect = 1e-31
 Identities = 75/158 47%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 50. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 127.7 bits 480,  Expect = 2e-31
 Identities = 72/159 45%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD + L+PK+  + V S+E VEG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P+KY+K ++  +D  N+   Y++IEG  +GDK+E I  ++K  AA DGG + K T++
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E    GK +   L+K +EAYLLA+ + Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 51. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 127.7 bits 480,  Expect = 2e-31
 Identities = 72/159 45%, Positives = 107/159 67%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD ++L+PK+  + V S+E VEG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P+KY+K ++  +D  N+   Y++IEG  +GDK+E I  ++K  AA DGG + K T++
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E    GK +   L+K +EAYLLA+ + Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 52. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 127.5 bits 479,  Expect = 2e-31
 Identities = 75/158 47%, Positives = 106/158 67%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E+I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 53. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 127.2 bits 478,  Expect = 2e-31
 Identities = 75/158 47%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 54. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 127.2 bits 478,  Expect = 2e-31
 Identities = 75/158 47%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 55. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 127.2 bits 478,  Expect = 2e-31
 Identities = 70/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K+ A  DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH +  E     K KA  L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 56. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 127.0 bits 477,  Expect = 2e-31
 Identities = 78/156 50%, Positives = 111/156 71%, Gaps = 5/156 3%
Query  1    MGVNTFTHES--TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMN 58
            MGV  FTHES  T+ IAP RLFK L LD D+L+ K+L + +KS EI+EG+GG G+IK++ 
Sbjct  1    MGV--FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKIT 58
Query  59   FVEGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTT 118
            F E    KY KH+I  +D +N    +S+IEGD L   +ES++ ++K  A+ DGG + K+T
Sbjct  59   FGEASKFKYAKHRIDALDPENCTYSFSVIEGDAL-TVMESVSTEIKCVASPDGGSIMKST 117
Query  119  TEYHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            T+Y+TKGD  + EE+      KA  L+KA+EAYL+A+P +Y
Sbjct  118  TKYQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 57. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 127.0 bits 477,  Expect = 3e-31
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLDFD L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ E+    K  A  L++A+E+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 58. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 126.7 bits 476,  Expect = 3e-31
 Identities = 75/158 47%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 59. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 126.7 bits 476,  Expect = 3e-31
 Identities = 74/158 46%, Positives = 105/158 66%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG+ TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH++  ID+ +    Y+LIEGD L D +E I+Y+ K+ A+G G  + K+ + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 60. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 126.5 bits 475,  Expect = 4e-31
 Identities = 70/159 44%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLDFD L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE ++ ++K  AA  GG + K + +
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 61. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 126.5 bits 475,  Expect = 4e-31
 Identities = 71/159 44%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+LVPK+  + + S+E +EG+GG G+IK++NF 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 62. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 126.2 bits 474,  Expect = 4e-31
 Identities = 74/158 46%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF +E T+ I P+RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YH KG+  + EE   VGK K   LFK IE+YL  +P  Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 63. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 126.2 bits 474,  Expect = 4e-31
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK ++LD D L+PK+    V S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   +S+IEG  +GD LE +  ++K  AA DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +HTKGDH ++ E+  + K KA+ L+KA+E+YLLA+   Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 64. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 126.0 bits 473,  Expect = 5e-31
 Identities = 69/159 43%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 65. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 126.0 bits 473,  Expect = 5e-31
 Identities = 70/159 44%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   R+FK ++LD D LVPK+  + + S+E +EG+GG G+IK++NF 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 66. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 125.7 bits 472,  Expect = 6e-31
 Identities = 70/159 44%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG V K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 67. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 125.5 bits 471,  Expect = 7e-31
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 68. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 125.5 bits 471,  Expect = 7e-31
 Identities = 69/159 43%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++NF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 69. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 125.2 bits 470,  Expect = 8e-31
 Identities = 70/158 44%, Positives = 108/158 68%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+T+ I   RLFK ++LD + L+PK+  + V S+E VEG+GG G+IK++ F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P+KY+K ++  ID  N+   Y++IEGDVLGDKLE +++++K  AA  GG + K ++++
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            H KG H V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 70. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 125.2 bits 470,  Expect = 9e-31
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 71. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 124.7 bits 468,  Expect = 1e-30
 Identities = 68/158 43%, Positives = 102/158 64%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+T+ I   RLFK ++LD D+L+PK+  + + S+E +EG+GG G+IK++ F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K+ A  DGG + K + +Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            HTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 72. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 124.7 bits 468,  Expect = 1e-30
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 73. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 124.5 bits 467,  Expect = 1e-30
 Identities = 72/156 46%, Positives = 102/156 65%, Gaps = 0/156 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF  ++T+ +AP  L+K +  D D++ PK L    KS+EIVEG+GG G+IK+++FV
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L +  E I +D K+    +GG + K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            YH+KGD   +E+E   GK K+  LFKA+EAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 74. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 124.4 bits 467,  Expect = 1e-30
 Identities = 67/158 42%, Positives = 104/158 65%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+ + I   RLFK ++LD D L+PK+    V S+E +EG+GG G+IK++ F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P KY+K ++  +D  N+   +S+IEG  +GD LE +  ++K  AA DGG + K + ++
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            HTKGDH ++ E+  + K KA+ L+KA+E+YLLA+   Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 75. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 124.4 bits 467,  Expect = 1e-30
 Identities = 69/159 43%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 76. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 124.4 bits 467,  Expect = 1e-30
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 77. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 124.2 bits 466,  Expect = 2e-30
 Identities = 68/159 42%, Positives = 106/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ E+    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 78. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 124.2 bits 466,  Expect = 2e-30
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 79. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 124.2 bits 466,  Expect = 2e-30
 Identities = 70/159 44%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F 
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 80. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 124.0 bits 465,  Expect = 2e-30
 Identities = 72/155 46%, Positives = 101/155 65%, Gaps = 1/155 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  T+  E  ++I+  ++FK +VLD D+++PK L H +  ++ +EGDGG G+IK   F 
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   K +KH+I  +D +N+   YS+IEG  L D +ESI+Y +K  A  DGGC+CK  + 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            Y  K D  VSEEE   GK +A  +FK +EAYLLANP
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 81. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 123.9 bits 465,  Expect = 2e-30
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + +  +E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 82. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 123.9 bits 465,  Expect = 2e-30
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 83. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 123.9 bits 465,  Expect = 2e-30
 Identities = 68/159 42%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + +   RLFK  VLDFD L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE ++ ++   AA  GG + K + +
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 84. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 123.9 bits 465,  Expect = 2e-30
 Identities = 68/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ E+    K  A  L++A+E+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 85. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 123.7 bits 464,  Expect = 2e-30
 Identities = 75/155 48%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            M V TF  ++T+ +AP  L+K LV D D++VPK +    KS+EIVEG+GG G+IK+++FV
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L D  E I+ D K+    +GG V K + +
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            YH+KGD   +E+E   GK K+  LFK IEAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 86. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 123.7 bits 464,  Expect = 2e-30
 Identities = 68/159 42%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P K++K ++  +D+ N+   Y++IEGDVLGD LE +++++K  AA  GG + K +++
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH V+ EE    K  A  L++A+E+YLLA+   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 87. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 123.7 bits 464,  Expect = 2e-30
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+LVPK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 88. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 123.7 bits 464,  Expect = 2e-30
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 89. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 122.9 bits 461,  Expect = 4e-30
 Identities = 69/159 43%, Positives = 104/159 65%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 90. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 122.7 bits 460,  Expect = 5e-30
 Identities = 71/155 45%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV TF  ++T+ +AP  L+K +  D D++ PK L    KS+EIVEG+GG G+IK+++FVE
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
             G  K++ HKI  ID+ NL   YS++ G  L +  E I +D K+    +GG + K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            H+KGD   +E+E   GK K+  LFKA+EAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 91. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 122.4 bits 459,  Expect = 6e-30
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD+ +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 92. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 122.2 bits 458,  Expect = 7e-30
 Identities = 67/159 42%, Positives = 105/159 66%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L+PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K+ A  DGG + + + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH +  E     K K   L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 93. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 121.9 bits 457,  Expect = 8e-30
 Identities = 68/159 42%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 94. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 121.9 bits 457,  Expect = 8e-30
 Identities = 68/159 42%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGG + K + +
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 95. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 121.9 bits 457,  Expect = 8e-30
 Identities = 68/159 42%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
             G P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGCV K + +
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKG+H V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 96. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 121.7 bits 456,  Expect = 1e-29
 Identities = 68/159 42%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 97. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 121.4 bits 455,  Expect = 1e-29
 Identities = 68/159 42%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGG + K + +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 98. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 121.2 bits 454,  Expect = 1e-29
 Identities = 75/155 48%, Positives = 100/155 64%, Gaps = 1/155 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF  E  + +AP  L+K LV D D+++PK L    KS+E VEG+GG G+IK++ F+
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G  K++ HKI  ID+ NL   YS++ G  L D  E I +D K+ A  +GG   K T +
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            Y TKGD   +++E   GK KA  LFKAIEAYLLA+P
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 99. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 121.2 bits 454,  Expect = 1e-29
 Identities = 68/158 43%, Positives = 103/158 65%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G   KY+K ++  +D+ N+   Y++IEGDVLGDKLE + +++K  AA  GG + K ++++
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 100. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 121.2 bits 454,  Expect = 1e-29
 Identities = 69/159 43%, Positives = 103/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E VEG+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE +  ++K  AA  GG + K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 101. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 120.9 bits 453,  Expect = 2e-29
 Identities = 67/158 42%, Positives = 104/158 65%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K ++++
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            H KG H V+ EE    K  A  L++A+E+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 102. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 120.7 bits 452,  Expect = 2e-29
 Identities = 68/158 43%, Positives = 102/158 64%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P KY+K ++  +D  N+   YSLIEG  +GD LE I+ ++K  A  DGG + K + +Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            HTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 103. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 119.7 bits 448,  Expect = 4e-29
 Identities = 71/155 45%, Positives = 98/155 63%, Gaps = 1/155 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            M V TF  ++T+ +AP  L+  L  D D+++PK +    +S+EIVEG+GG G+IK+++FV
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G  K++ HKI  +D+ NL   YS++ G  L D  E I  D K     DGG + K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            YH KGD   +E+E   GK K+  LFKA+EAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 104. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 119.7 bits 448,  Expect = 4e-29
 Identities = 72/157 45%, Positives = 100/157 63%, Gaps = 2/157 1%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV TF  E T+T+ P +L+  +  D DS+ PK++  DVKS+EIVEG+GG G+IK++  V
Sbjct  1    MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIID-DVKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G  K++ HK+  ID+ N    YS++ G  L    E I ++ K+    +GG + K T +
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGD    EEE   GK K   LF+AIE Y+LANP+ Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 105. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 119.4 bits 447,  Expect = 5e-29
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  +GG + K   +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 106. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 119.2 bits 446,  Expect = 6e-29
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  +GG + K   +
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 107. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 118.9 bits 445,  Expect = 7e-29
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  +GG + K   +
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 108. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 118.4 bits 443,  Expect = 1e-28
 Identities = 67/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+T+ I   RLFK ++LD D+L PK+  + + S+E +EG+GG G+IK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG P KY+K ++  +  KN+   YS+IEG  +GD LE I+ ++K  A  DG  + K + +
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            YHTKGDH V  E+    K     L++A+E+YLLA+   Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 109. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 118.4 bits 443,  Expect = 1e-28
 Identities = 68/159 42%, Positives = 102/159 64%, Gaps = 0/159 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV  +  E+ + I+  RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F 
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG   KY+K ++  +D+ N+   Y++IEGDVLGDKLE +  ++K  AA  GG   K +++
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            +H KGDH ++ EE    K  A  L++A+E YLLA+ + Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 110. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 118.2 bits 442,  Expect = 1e-28
 Identities = 66/158 41%, Positives = 104/158 65%, Gaps = 0/158 0%
Query  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
            GV  +  E+ + I   RLFK  VLD D L+PK+  + + S+E V G+GG G+IK + F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
            G P K++K ++  +D+ N+   Y++IEGDVLGDKLE +++++K  AA  GG + K ++++
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            H KG H V+ E+    K  A  L++A+E+YLLA+ + Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 111. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 117.7 bits 440,  Expect = 1e-28
 Identities = 66/148 44%, Positives = 99/148 66%, Gaps = 2/148 1%
Query  6    FTHES-TTTIAPT-RLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVEGG 63
            F +ES TT++ P  RLFK ++L+ D+L+PK+  + + S+E +EG+GG G+IK++ F EG 
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   PIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYHT 123
            P KY+K ++  +D  N+   YS+IEG  LGD LE I  ++K  A  DGG + K + +YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  124  KGDHVVSEEEHNVGKGKAIDLFKAIEAYLL 153
            KGDH +  E     K K   L++A+E+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 112. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 116.9 bits 437,  Expect = 2e-28
 Identities = 63/148 42%, Positives = 98/148 66%, Gaps = 0/148 0%
Query  6    FTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVEGGPI 65
            +  E+T+ I   RLFK ++LD D+L PK+  + + S++ +EG+GG G+IK++NF EG P 
Sbjct  3    YETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPF 62
Query  66   KYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYHTKG 125
            KY+K ++  +D  N+   YS+IEG  +GD LE I+ ++K  A  DGGC+ K + +YHTKG
Sbjct  63   KYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKG 122
Query  126  DHVVSEEEHNVGKGKAIDLFKAIEAYLL 153
            +H V  E+    K     L++A+E+YLL
Sbjct  123  NHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 113. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 116.2 bits 434,  Expect = 4e-28
 Identities = 66/135 48%, Positives = 96/135 71%, Gaps = 1/135 0%
Query  11   TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVEGGPIKYLKH 70
            T+ I P +LFK +VLD D+L+PK+  + VKS+EI+EGDGG G++K++++ EG    Y+KH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   KIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYHTKGDHVVS 130
            KI  +D  N+V  YS+ EGD LGDK+E I+Y++K+ A+G G  + KTT+ YH KG   + 
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSII-KTTSHYHCKGGAEIK 120
Query  131  EEEHNVGKGKAIDLFK 146
            EE+   GK +A  LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 111.4 bits 415,  Expect = 1e-26
 Identities = 68/153 44%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV+TF  EST+ + P +LFK  V+D D L PKL+   ++SIEIVEG+GG G++K++  V
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPA-IQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E G   Y+ HKI  ID+      Y++  G  + + LE +++  K+EAA DGG   K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD  + +E H   K K+  +FKAIE Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 109.6 bits 408,  Expect = 4e-26
 Identities = 65/154 42%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV T   E T++++  ++F+G+V+D D+++PK      KS+EI +GDGG G++K + + 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            +GGPI  +  +I  ++ + L   YS+I+GD+L   +ESI   V +    DGG +CKTT  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 108.6 bits 404,  Expect = 9e-26
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV     E+ +T++  ++++G++LD D++ PK+L + +KS+EI+EGDGG G++K +++ 
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E      +K+K+ VID   L   Y+ I GD+L D LES+  +       DGGC+ K TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            Y+TKGD V+ E++      K+   FKA+EAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 107.8 bits 401,  Expect = 1e-25
 Identities = 63/155 40%, Positives = 94/155 60%, Gaps = 0/155 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV       T+++   +LFK L LD D+L+P++L   +K  EI+EGDGG G++K + + 
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            +  P K +K+KI  ID + +   YS+I+GD+L   ++SI   + F    DGGC   +T  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            ++TKGD VV EE       +   +FKA+EAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 104.8 bits 389,  Expect = 1e-24
 Identities = 62/154 40%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MGV     E+ +T++  ++++G++LD D++ PK+L + +KS+EI+EGDGG G+++ +++ 
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            E      +K+K+ VID   L   Y+ I GD+L + LES+          DGGC+ K TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            Y+TKGD V+ E++      K+   FKA+EAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 103.8 bits 385,  Expect = 2e-24
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 2/154 1%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            M V  F  E T++++P+ +FK +V+DFD++ PK      KSI+ +EGDGG G+IK + + 
Sbjct  1    MAVAEF--EITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            +G P    KHK+  ID  N+   Y++ EGDVL   +ES  + +KF  + DGG V K +  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156
            +  KGD  +++E  ++ K      FKAIE Y++++P
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 102.1 bits 378,  Expect = 8e-24
 Identities = 60/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  + + E T++++  ++F G+VLD D+++PK  +   KS+E V+GDGGAG+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG PI  +  +   ++ + L    ++I+GD+L   +ESI   +      DGG + KTT  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 101.8 bits 377,  Expect = 9e-24
 Identities = 60/154 38%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  + + E T++++  ++F G+VLD D+++PK      KS+E V+GDGGAG+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG PI  +  +   ++ + L    ++I+GD+L   +ESI   +      DGG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 101.5 bits 376,  Expect = 1e-23
 Identities = 59/154 38%, Positives = 95/154 61%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  + + E T++++  ++F G+VLD D+++PK      KS++ V+GDGGAG+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG PI  +  +   ++ + L    ++I+GD+L + +ESI   +      DGG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 100.0 bits 370,  Expect = 3e-23
 Identities = 59/154 38%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  + + E T++++  ++F G+VLD D+++PK      KS++ V+GDGGAG+++ + + 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG PI  +  +   ++ + L    ++I+GD+L   +ESI   +      DGG + KTT  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 98.7 bits 365,  Expect = 8e-23
 Identities = 58/154 37%, Positives = 94/154 61%, Gaps = 1/154 0%
Query  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
            MG  + + E T++++  ++F  +VLD D+++PK      KS++ V+GDGGAG+++ + + 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
            EG PI  +  +   ++ + L    ++I+GD+L + +ESI   +      DGG + KTT  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLAN 155
            +HTKGD VV EE       +   LFKAIEAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 62.5 bits 220,  Expect = 4e-12
 Identities = 42/86 48%, Positives = 53/86 61%, Gaps = 11/86 12%
Query  74   VIDDKNLVTK-----------YSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYH 122
            V+D  NL+ K           Y  +EGD L D LE I Y+ K+ +A     + KTT++YH
Sbjct  3    VLDADNLIPKKITFGEGSQYGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYH 62
Query  123  TKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159
            TKGD  + EE    GK KA  LFK IE YL  +PS Y
Sbjct  63   TKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 99

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 51.6 bits 175,  Expect = 4e-09
 Identities = 28/45 62%, Positives = 36/45 80%, Gaps = 2/45 4%
Query  6    FTHES--TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGG 50
            FTHES  T+ IAP RLFK L LD D+L+ K+L + +KS EI+EG+GG
Sbjct  3    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 49.2 bits 168,  Expect = 6e-08
 Identities = 30/94 31%, Positives = 49/94 52%, Gaps = 0/94 0%
Query  3    VNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVEG 62
            V  F  ++  ++    L+  L  DF ++VPK+L H VK ++++EGDGG G+I   NF+  
Sbjct  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
Query  63   GPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKL 96
                Y + +I   D+ +      +IEG  L   L
Sbjct  62   VSPSYQREEITEFDESSHEIGLQVIEGGYLNQGL 95

Sequence Alignment: 128. Allergen Name: Act d 11.0101 Sequence ID: P85524

 Score = 36.8 bits 119,  Expect = 0.0003
 Identities = 29/119 24%, Positives = 58/119 48%, Gaps = 6/119 5%
Query  30   LVPKLLSHDVKSIEIVEGD-GGAGSIKQMNFVEGGPIKYLKHKIHVIDDKNLVTKYSLIE 88
            L+ ++   +++ ++++EG+ G  GS+    +   G  K  K  +  ID++     + ++E
Sbjct  30   LISEMSPVNIQGVDLLEGNWGTVGSVIFFKYTIDGKEKTAKDIVEAIDEETKSVTFKIVE 89
Query  89   GDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYHTKGDHVVSEEEHNVGKGKAIDLFKAI 148
            GD++ +  ++    V+ +  G+   V  T      K D     EE N      I++ K I
Sbjct  90   GDLM-ELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKED----VEEPNTLMNFCIEITKDI 144
Query  149  EAYLL 153
            E Y L
Sbjct  145  ETYHL 149

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.