The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG
EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY
QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLYT
Sequence Info Allergen Name Length Opt Bits Score E Value
QGS84240 Que i 1.0101 159 1010 236.1 3.4e-64
ABZ81045 Que a 1.0201 159 875 205.7 5.1e-55
QOL10866 Que ac 1.0101 159 866 203.6 2.1e-54
ABZ81047 Que a 1.0401 160 764 180.6 1.8e-47
ABZ81046 Que a 1.0301 160 757 179.0 5.3e-47
AUH28179 Que m 1.0101 160 748 177.0 2.2e-46
CAD10374 Cas s 1 160 688 163.4 2.6e-42
APD76154 Jug r 5.0101 160 685 162.8 4.2e-42
ACJ23864 Fag s 1.0101 160 671 159.6 3.7e-41
O50001 Pru ar 1 160 661 157.3 1.8e-40
CAA96549 Cor a 1.0301 160 651 155.1 8.5e-40
Q2I6V8 Pru p 1.0101 160 644 153.5 2.5e-39
O24248 Pru av 1 160 638 152.2 6.5e-39
Q39427 Bet v 1.0205 160 630 150.4 2.3e-38
P43186 Bet v 1.0204 160 629 150.1 2.7e-38
CAA96535 Mal d 1.0401 160 628 149.9 3.1e-38
CAA96537 Mal d 1.0403 160 626 149.4 4.3e-38
CAA54696.1 Bet v 1.0301 160 623 148.8 6.8e-38
B6CQS9 Pru du 1.0101 160 622 148.5 8e-38
CAA04828.1 Bet v 1.0206 159 621 148.3 9.2e-38
CAA96536 Mal d 1.0402 160 616 147.2 2e-37
P43184 Bet v 1.0203 160 616 147.2 2e-37
CAA96548 Cor a 1.0201 160 615 147.0 2.4e-37
AAO25113 Mal d 1.0304 159 614 146.7 2.8e-37
CAA54421 Bet v 1.0201 160 613 146.5 3.3e-37
CAA54481 Bet v 1.0202 160 613 146.5 3.3e-37
AAB24432 Aln g 1 160 611 146.1 4.4e-37
CAB02160 Bet v 1.0113 160 610 145.8 5.2e-37
AAB01362 Mal d 1.0201 159 609 145.6 6e-37
AAD26545 Mal d 1.0202 159 609 145.6 6e-37
AAD26558 Mal d 1.0205 159 607 145.2 8.3e-37
CAA07329.1 Bet v 1.0118 160 607 145.2 8.3e-37
AAD26546 Mal d 1.0103 159 606 144.9 9.7e-37
AAD26554 Mal d 1.0106 159 605 144.7 1.1e-36
AAD26553 Mal d 1.0105 159 605 144.7 1.1e-36
AAD26548 Mal d 1.0204 159 605 144.7 1.1e-36
CAB02161 Bet v 1.0114 160 605 144.7 1.1e-36
CAA33887 Bet v 1.0101 160 605 144.7 1.1e-36
CAB02159 Bet v 1.0112 160 605 144.7 1.1e-36
AAD29671 Mal d 1.0108 159 604 144.5 1.3e-36
AAD13683 Mal d 1.0206 159 604 144.5 1.3e-36
O65200 Pyr c 1 159 604 144.5 1.3e-36
P38948 Aln g 1 159 604 144.5 1.3e-36
CAB02156 Bet v 1.0109 160 604 144.5 1.3e-36
AAD26552 Mal d 1.0104 159 603 144.3 1.5e-36
AAK13030 Mal d 1.0207 159 603 144.3 1.5e-36
AAD26547 Mal d 1.0203 159 603 144.3 1.5e-36
Q256S7 Fra a 1 160 602 144.0 1.8e-36
AAG40329 Cor a 1.0402 161 602 144.0 1.8e-36
CAA54487 Bet v 1.0106 160 601 143.8 2.1e-36
AAK13029 Mal d 1.0109 159 600 143.6 2.5e-36
AAD26555 Mal d 1.0107 159 600 143.6 2.5e-36
Q3T923 Fra a 1 160 600 143.6 2.5e-36
CAA54483 Bet v 1.0103 160 600 143.6 2.5e-36
CAA58646 Mal d 1.0101 159 599 143.4 2.9e-36
AAD48405 Cor a 1.0401 161 599 143.4 2.9e-36
AAG40330 Cor a 1.0403 161 599 143.4 2.9e-36
CAA04827.1 Bet v 1.0116 159 597 142.9 3.9e-36
CAA54484 Bet v 1.0104 160 596 142.7 4.6e-36
AAG40331 Cor a 1.0404 161 596 142.7 4.7e-36
CAD32318 Mal d 1.0208 158 595 142.5 5.4e-36
AAK13027 Mal d 1.0302 159 595 142.5 5.4e-36
CAB02157 Bet v 1.0110 160 595 142.5 5.4e-36
CAA96534 Mal d 1.0301 159 593 142.0 7.4e-36
Q256S6 Fra a 1 160 593 142.0 7.4e-36
CAB02217 Car b 1.0302 161 593 142.0 7.5e-36
CAA88833 Mal d 1.0102 159 592 141.8 8.6e-36
CAA07323.1 Bet v 1.0117 160 592 141.8 8.7e-36
CAA96547 Bet v 1.0115 160 591 141.5 1e-35
CAA54485 Bet v 1.0105 160 591 141.5 1e-35
CAB02155 Bet v 1.0108 160 591 141.5 1e-35
CAA54482 Bet v 1.0102 160 588 140.9 1.6e-35
Q256S2 Fra a 1 160 584 140.0 3e-35
CAA54489 Bet v 1.0107 160 584 140.0 3e-35
CAB02158 Bet v 1.0111 160 583 139.7 3.6e-35
CAB02216 Car b 1.0301 161 583 139.7 3.6e-35
Q256S4 Fra a 1 159 581 139.3 4.8e-35
ACF75030.1 Bet v 1.0207 150 578 138.6 7.2e-35
CAA50325 Cor a 1.0103 160 577 138.4 9.1e-35
AFN42528 Can s 5.0101 161 577 138.4 9.2e-35
AAK13028 Mal d 1.0303 159 576 138.2 1.1e-34
CAA50327 Cor a 1.0101 160 565 135.7 5.9e-34
CAA50328 Cor a 1.0102 160 563 135.2 8.1e-34
Q08407 Cor a 1 159 558 134.1 1.8e-33
CAB02207 Car b 1.0104 160 554 133.2 3.3e-33
CAB02206 Car b 1.0103 160 554 133.2 3.3e-33
CAB02208 Car b 1.0105 160 551 132.5 5.3e-33
ABZ81040 Car b 1.0109 160 544 130.9 1.6e-32
ABZ81043 Car b 1.0112 160 544 130.9 1.6e-32
ABZ81042 Car b 1.0111 160 544 130.9 1.6e-32
ABZ81041 Car b 1.0110 160 543 130.7 1.9e-32
CAM31908 Act c 8.0101 159 542 130.5 2.2e-32
ABC41615.1 Bet v 1.0119 150 541 130.3 2.4e-32
CAB02209 Car b 1.0106 160 541 130.3 2.5e-32
ABZ81044 Car b 1.0113 160 540 130.0 3e-32
ADK39021 Ost c 1.0101 160 539 129.8 3.5e-32
CAB02213 Car b 1.0107 160 538 129.6 4.1e-32
CAA50326 Cor a 1.0104 160 537 129.4 4.7e-32
P38950 Car b 1 159 536 129.1 5.5e-32
CAB02215 Car b 1.0108 160 528 127.3 1.9e-31
CAA47357 Car b 1.0102 159 526 126.9 2.6e-31
CAM31909 Act d 8.0101 157 522 126.0 4.9e-31
P38949 Car b 1 159 513 123.9 2e-30
AHC08073 Sola l 4.0101 160 497 120.3 2.5e-29
Q0Z8U9 Rub i 1.0101 137 491 119.0 5.3e-29
CAA42646 Gly m 4 158 485 117.6 1.6e-28
NP_001275580 Sola l 4.0201 160 480 116.5 3.5e-28
CAA43637 Pha v 1 156 446 108.8 7e-26
CAA67246 Pet c PR10 155 444 108.4 9.5e-26
P25985 Pha v 1 155 439 107.2 2.1e-25
CAA43636 Pha v 1 155 436 106.6 3.3e-25
AAQ91847 Ara h 8.0101 157 436 106.6 3.4e-25
AAB92255 Tar o RAP 157 422 103.4 3e-24
EF436550 Ara h 8.0201 153 420 103.0 4e-24
CAA75803 Lyc e 4.0101 178 417 102.2 7.7e-24
Q2VU97 Vig r 1.0101 155 412 101.1 1.4e-23
P92918 Api g 1.0201 159 408 100.2 2.7e-23
AAL76932 Dau c 1.0201 154 401 98.7 7.9e-23
P49372 Api g 1 154 397 97.8 1.5e-22
CAB03716 Dau c 1.0104 154 374 92.6 5.4e-21
CAB06416 Dau c 1.0105 154 371 91.9 8.7e-21
BAA13604 Dau c 1.0102 154 370 91.7 1e-20
AAB01092 Dau c 1.0101 168 368 91.2 1.5e-20
CAB03715 Dau c 1.0103 154 357 88.7 7.7e-20
P85126 Que a 1.0101 50 263 67.8 5e-14
Q5ULZ4 Fra a 1.0101 100 223 58.6 5.9e-11
Q9S8Q4 Cas s 1 24 143 40.9 3e-06
Q9ZWP8 Vig r 6.0101 155 156 43.4 3.5e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 236.1 bits 1010,  Expect = 3e-64
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
            EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLYT 159
            QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLYT
Sbjct  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLYT 159

Sequence Alignment: 2. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 205.7 bits 875,  Expect = 5e-55
 Identities = 141/158 89%, Positives = 144/158 91%, Gaps = 0/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV THESQETSVI PARLFKA+ LDSDNLI KVLPQAIKS E IEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
            EASKFKY+KHRIDALDPENCTYSFSVIEGDALT M SVSTEIK VASPDGGSI KSTTKY
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTVMESVSTEIKCVASPDGGSIMKSTTKY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            QTKGDFQLKEEQIQA IEK  GL KAVEAYL+AHPDLY
Sbjct  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 3. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 203.6 bits 866,  Expect = 2e-54
 Identities = 134/158 84%, Positives = 144/158 91%, Gaps = 0/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ESQETSVIPPARLFKAFVLDSDNLI KVLP+A+KS E IEGNGGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
            EASK KY+KHRID LDPENC+YSFSVIEG+ALTD+ S+STE+KFVASPDGGSI KSTTKY
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIASISTEVKFVASPDGGSIMKSTTKY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            QTKG FQLKEEQIQA +EK TGL KAVEAYLLAHPDLY
Sbjct  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLY 158

Sequence Alignment: 4. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 180.6 bits 764,  Expect = 2e-47
 Identities = 123/158 77%, Positives = 136/158 86%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV THESQETSVI PARLFKA+ LDSDNLI KVLPQAIKS E IEGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S +K++KHRID +DPEN TYSFSVIEGDAL D + +VSTE K VASPDGGSI KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            YQTKGDFQL +E I+   EK +G+ KAVEAYL+AHPDLY
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 5. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 179.0 bits 757,  Expect = 5e-47
 Identities = 120/158 75%, Positives = 137/158 86%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES++ SVIPPARLFKAFVLDSDNLIPKV+PQA+KS E IEGNGGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S +K++KHRID +DPEN TYSFSVIEGDAL D + +VSTE K VASPDGGSI KST+K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            YQTKGDFQL +E I+   EK + + KAVEAYL+AHPDLY
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 6. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 177.0 bits 748,  Expect = 2e-46
 Identities = 118/158 74%, Positives = 135/158 85%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ES++ SVIPPARLFKAFVLDSDNLIPKV+PQA+KS E IEGNGGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S +K++KHRID +DPEN T+SFSVIEGDAL D + +VSTE K VASPDGGSI KST K
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            YQTKGDFQL +E I+   EK +G+ KAVEAYL+AHPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 7. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 163.4 bits 688,  Expect = 3e-42
 Identities = 108/158 68%, Positives = 129/158 81%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV THE++ TS IPP RLFKAFVLD+DNLIPK+ P+AIKS E IEGNGGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S+FKY KHRID +D  N TY +SVIEGD + +++  +S EIK VASPDGGSI K+T+K
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE++ A  EK  GL KAVEAYLLAH D Y
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAY 159

Sequence Alignment: 8. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 162.8 bits 685,  Expect = 4e-42
 Identities = 106/158 67%, Positives = 128/158 81%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TSVIPPARLFKAFVLD+DNLIPKV+PQA+KS E IEGNGGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++KY KHR DA+D  N TY++SVIEGDAL D +  +S E K VAS +GGSI KS + 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y++KGD ++KEE ++   EK +GL KAVE YLLAHPD Y
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAY 159

Sequence Alignment: 9. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 159.6 bits 671,  Expect = 4e-41
 Identities = 106/158 67%, Positives = 133/158 84%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ T+VI PARLFKAFVLD+DNLIPKV PQAIKS E IEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S+F Y KHRID +D  N TY+ ++IEGDA+++ +  ++ EIK+VASPDGGSI KST+K
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KE+QI+A  E+ +G+ KAVEAYLLA+P  Y
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAY 159

Sequence Alignment: 10. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 157.3 bits 661,  Expect = 2e-40
 Identities = 97/158 61%, Positives = 132/158 83%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TSVIPP +LFKAF+LD+DNLIPKV P A+K  E +EG+GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHR+D +D +N +YS+++IEGDAL+D++ +++ +IK+VASPDGGSI K+T+ 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEEQ++A  EK  GL K VEAYLLA+PD Y
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAY 159

Sequence Alignment: 11. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 155.1 bits 651,  Expect = 9e-40
 Identities = 104/158 65%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIPPARLFK FVLDSDNLIPKV P+AIKSIE IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S F Y K++++ +D  N +Y +SVIEGDAL+D +  ++ EIK VASP GGSI KS +K
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+T GD +LK+EQI+A  EK +GL KAVE YLLAH D Y
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAY 159

Sequence Alignment: 12. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 153.5 bits 644,  Expect = 3e-39
 Identities = 98/158 62%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ TS IPP RLFKAFVLD+DNL+PK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D EN +YS+++IEGDAL D +  +S E K+VASP GGSI KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HPD Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 13. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 152.2 bits 638,  Expect = 7e-39
 Identities = 97/158 61%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ TS IPP RLFKAFVLD+DNL+PK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D EN +YS+++IEGDAL D +  +S E K+VASP GGSI KST+ 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK + L K +E YL  HPD Y
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAY 159

Sequence Alignment: 14. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 150.4 bits 630,  Expect = 2e-38
 Identities = 99/158 62%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNLIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK+VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAY 159

Sequence Alignment: 15. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 150.1 bits 629,  Expect = 3e-38
 Identities = 100/158 63%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ES+ TSVIP ARLFKAF+LD DNLIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 149.9 bits 628,  Expect = 3e-38
 Identities = 94/158 59%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP  RLFKAF+LD DNLIPK+ PQAIKS E IEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+D +  ++ E K++ASPDGGSI K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+ KGD ++KEE+++A  EK +GL K +EAYLLAH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 149.4 bits 626,  Expect = 4e-38
 Identities = 94/158 59%, Positives = 126/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP  RLFKAF+LD DNLIPK+ PQAIKS E IEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+D +  ++ E K++ASPDGGSI K+T+ 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+ KGD ++KEE+++A  EK +GL K +EAYLLAH D Y
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 18. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 148.8 bits 623,  Expect = 7e-38
 Identities = 99/158 62%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E + TSVI PARLFK+FVLD+DNLIPKV P+ + S E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY KHR+D +D  N  Y +S+IEG  L D +  +S EIK VA+P GGSI K T+K
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD  L EE+I+A  EK  GL KAVE YL+AHP+ Y
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAY 159

Sequence Alignment: 19. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 148.5 bits 622,  Expect = 8e-38
 Identities = 93/158 58%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG+ T+  + TSVIPP RLFKA+VL++D LIPK+ PQ++KS E +EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+ID LD +N  Y++S++EGDAL+D V  +S EIK+VAS DGGS+ KST+ 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE ++A  EK TGL K +E YL+A+PD Y
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAY 159

Sequence Alignment: 20. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 148.3 bits 621,  Expect = 9e-38
 Identities = 99/157 63%, Positives = 120/157 76%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +ES+ TSVIP ARLFKAF+LD DNLIPKV PQAI S+E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
             S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK+VA+PDGGSI K + KY
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            +TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 21. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 147.2 bits 616,  Expect = 2e-37
 Identities = 92/158 58%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP  RLFKAF+LD DNLIPK+ PQAIKS + IEG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y K+R++ +D +N TYS+S+IEGD L+D +  ++ E K++ASPDGGSI K+ + 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+ KGD ++KEE+++A  EK +GL K +EAYLLAH D Y
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAY 159

Sequence Alignment: 22. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 147.2 bits 616,  Expect = 2e-37
 Identities = 98/158 62%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ES+ TSVIP ARLFKAF+L+ D LIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 23. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 147.0 bits 615,  Expect = 2e-37
 Identities = 95/158 60%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD +NLIPKV PQA+ S+E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R++ +D  N  YS++VIEG  + D V  +  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++  E+I+   EK+ GL +AVEAYLLAH D Y
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAY 159

Sequence Alignment: 24. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 146.7 bits 614,  Expect = 3e-37
 Identities = 96/157 61%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KHRID +D EN  Y +SVIEGDA+++ +  +S E K+VAS   GS+ KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YLL HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAY 158

Sequence Alignment: 25. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 146.5 bits 613,  Expect = 3e-37
 Identities = 97/158 61%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+L+ D LIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 26. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 146.5 bits 613,  Expect = 3e-37
 Identities = 98/158 62%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ES+ TSVIP ARLFKAF+L+ D LIPKV PQAI S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 27. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 146.1 bits 611,  Expect = 4e-37
 Identities = 97/158 61%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFKAF+LD D L+PKV P+A+ S+E IEGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S FKY K R+D +D  N  YSFSVIEG A+ D +  V  EIK VA+PDGGSI K + K
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++TKGD ++  EQI+   EK  GL KAVE+YLLAH D Y
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 159

Sequence Alignment: 28. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 145.8 bits 610,  Expect = 5e-37
 Identities = 95/158 60%, Positives = 119/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL+PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGGSI K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 145.6 bits 609,  Expect = 6e-37
 Identities = 96/157 61%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 30. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 145.6 bits 609,  Expect = 6e-37
 Identities = 96/157 61%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 31. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 145.2 bits 607,  Expect = 8e-37
 Identities = 96/157 61%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE++ A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 32. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 145.2 bits 607,  Expect = 8e-37
 Identities = 95/158 60%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNLIPKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK+VA+PDGGSI + + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K E+++A  EK   L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAY 159

Sequence Alignment: 33. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 144.9 bits 606,  Expect = 1e-36
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 34. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 94/157 59%, Positives = 124/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD + ++S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 35. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 36. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 95/157 60%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K++AS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 37. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGGSI K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAY 159

Sequence Alignment: 38. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGGSI K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 39. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 144.7 bits 605,  Expect = 1e-36
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGGSI K + K
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 40. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 144.5 bits 604,  Expect = 1e-36
 Identities = 94/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 41. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 144.5 bits 604,  Expect = 1e-36
 Identities = 95/157 60%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFK FVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 42. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 144.5 bits 604,  Expect = 1e-36
 Identities = 93/157 59%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG+ T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHR+D++D  + +Y++++IEGDALTD +  +S E K+VAS  G +IK S + 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 43. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 144.5 bits 604,  Expect = 1e-36
 Identities = 96/157 61%, Positives = 116/157 73%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E++  SVIP ARLFKAF+LD D L+PKV P+A+ S+E IEGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
             S FKY K R+D +D  N  YSFSVIEG A+ D +  V  EIK VA+PDGGSI K + K+
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            +TKGD ++  EQI+   EK  GL KAVE+YLLAH D Y
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAY 158

Sequence Alignment: 44. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 144.5 bits 604,  Expect = 1e-36
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGGSI K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 45. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 144.3 bits 603,  Expect = 2e-36
 Identities = 94/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 46. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 144.3 bits 603,  Expect = 2e-36
 Identities = 95/157 60%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 47. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 144.3 bits 603,  Expect = 2e-36
 Identities = 95/157 60%, Positives = 123/157 78%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK  GL K +E++L  HPD Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAY 158

Sequence Alignment: 48. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 144.0 bits 602,  Expect = 2e-36
 Identities = 92/158 58%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P GG+I K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 49. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 144.0 bits 602,  Expect = 2e-36
 Identities = 96/158 60%, Positives = 118/158 74%, Gaps = 2/158 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV ++E + TSVIPPARLFK+FVLD+DNLIPKV PQ     E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGG-SIKKSTT 118
            E S+FKY KH+++ +D  N  Y +S+IEG  L   +  +S EIK  A+P GG SI K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            KY+TKG+  + EE+I+A  EK  GL KAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 143.8 bits 601,  Expect = 2e-36
 Identities = 96/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  + D +  +S EIK VA+P+GGSI K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 51. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 143.6 bits 600,  Expect = 2e-36
 Identities = 93/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++   EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 52. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 143.6 bits 600,  Expect = 2e-36
 Identities = 93/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++A   K  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 53. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 143.6 bits 600,  Expect = 2e-36
 Identities = 90/158 56%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQA+K  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P GG++ K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 54. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 143.6 bits 600,  Expect = 2e-36
 Identities = 96/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  + D +  +S EIK VA+P+GGSI K   K
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 55. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 143.4 bits 599,  Expect = 3e-36
 Identities = 93/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++KEE+++   EK  GL K +E+YL  HPD Y
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAY 158

Sequence Alignment: 56. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 143.4 bits 599,  Expect = 3e-36
 Identities = 96/158 60%, Positives = 118/158 74%, Gaps = 2/158 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E + TSVIPPARLFK+FVLD+DNLIPKV PQ   S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGG-SIKKSTT 118
            E ++FKY KH+++ +D  N  Y +S+IEG  L   +  +S EIK  A+P GG SI K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            KY+TKG+  + EE+I+A  EK  GL KAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 57. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 143.4 bits 599,  Expect = 3e-36
 Identities = 96/158 60%, Positives = 117/158 74%, Gaps = 2/158 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E + TSVIPPARLFK+FVLD+DNLIPKV PQ     E +EGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGG-SIKKSTT 118
            E S+FKY KH+++ +D  N  Y +S+IEG  L   +  +S EIK  A+P GG SI K T+
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            KY+TKG+  + EE+I+A  EK  GL KAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 58. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 142.9 bits 597,  Expect = 4e-36
 Identities = 94/157 59%, Positives = 117/157 74%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
               FKY K R+D +D  N  YS+S+IEG  + D +  +S EIK VA+PDGGSI K + KY
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            +TKGD ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 158

Sequence Alignment: 59. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 142.7 bits 596,  Expect = 5e-36
 Identities = 96/158 60%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E + TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  YS+SVIEG  + D +  +S EIK VA+P+GGSI K   K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 60. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 142.7 bits 596,  Expect = 5e-36
 Identities = 95/158 60%, Positives = 118/158 74%, Gaps = 2/158 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV ++E + TSVIPPARLFK+FVLD+DNLIPKV PQ   S E +EGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGG-SIKKSTT 118
            E ++FKY KH+++ +D  N  Y +S+IEG  L   +  +  EIK  A+P GG SI K T+
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            KY+TKG+  + EE+I+A  EK  GL KAVEAYLLAHPD Y
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 61. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 142.5 bits 595,  Expect = 5e-36
 Identities = 94/156 60%, Positives = 122/156 78%, Gaps = 2/156 1%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV T+E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
             S++ Y KH+ID++D  N +Y++++IEGDALTD +  VS E K+VAS   GSI KS + Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            +TKGD ++ EE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAY 157

Sequence Alignment: 62. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 142.5 bits 595,  Expect = 5e-36
 Identities = 93/157 59%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KHRID +D +N  Y +SVIEGDA+++ +  +S E K+VA+   GS+ KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YLL H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAY 158

Sequence Alignment: 63. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 142.5 bits 595,  Expect = 5e-36
 Identities = 92/158 58%, Positives = 118/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D++  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 64. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 142.0 bits 593,  Expect = 7e-36
 Identities = 93/157 59%, Positives = 120/157 76%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIPPARLF AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KHRID +D EN  Y +SVIEGDA+++ +  +S E K+VAS   GS+ KST+ 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TK D ++KEE+++A  EK + L K +E YLLAH D Y
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAY 158

Sequence Alignment: 65. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 142.0 bits 593,  Expect = 7e-36
 Identities = 91/158 57%, Positives = 122/158 77%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQAIK  E +EG+GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P GG+I K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 66. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 142.0 bits 593,  Expect = 7e-36
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD +NLIPKV PQA+ S+E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S  KY K R++ +D  N  YS++VIEG  + D V  +  EIK VA+PDGGSI K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++  E+I+   E++ GL K VEAYLLAH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 67. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 141.8 bits 592,  Expect = 9e-36
 Identities = 92/157 58%, Positives = 121/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP+RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIK-SISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+ KG+ ++KEE+++   EK  GL K +E+YL  HPD Y
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAY 158

Sequence Alignment: 68. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 141.8 bits 592,  Expect = 9e-36
 Identities = 92/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 69. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 141.5 bits 591,  Expect = 1e-35
 Identities = 95/158 60%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +  +N  YS+SVIEG  + D +  +S EIK VA+PDG SI K + K
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++K EQI+A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 70. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 141.5 bits 591,  Expect = 1e-35
 Identities = 93/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +ES+ TSVIP ARLFKAF+L+ DNLIPKV PQAI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 71. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 141.5 bits 591,  Expect = 1e-35
 Identities = 92/158 58%, Positives = 117/158 74%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 72. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 140.9 bits 588,  Expect = 2e-35
 Identities = 92/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E + TSVIP ARLFKAF+LD DNL+PKV PQAI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 73. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 140.0 bits 584,  Expect = 3e-35
 Identities = 89/158 56%, Positives = 121/158 76%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQA+K  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+I ++D  N TYS+S+IEGDAL++ +  +  E K+V++P GG+I K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK   L K +E YL  HP  Y
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEY 159

Sequence Alignment: 74. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 140.0 bits 584,  Expect = 3e-35
 Identities = 90/158 56%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP AR+FKAF+LD D L+PKV PQAI S+E IEGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E   FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 75. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 139.7 bits 583,  Expect = 4e-35
 Identities = 91/158 57%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S+E IEGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
                FKY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG + K + K
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKG+ ++K EQ++A+ E    L +AVE+YLLAH D Y
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAY 159

Sequence Alignment: 76. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 139.7 bits 583,  Expect = 4e-35
 Identities = 92/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFKAF+LD + LIPKV PQA+ S+E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S  KY K R++ +D  N  YS++VIEG  + D V  +  EIK VA+PDGGSI K T+K
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++  E+I+   E++ GL K VEAYLLAH   Y
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEY 159

Sequence Alignment: 77. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 139.3 bits 581,  Expect = 5e-35
 Identities = 90/157 57%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E++ TS IP  +LFKAFVLD+DNLIPK+ PQA+K  E +EG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+I ++D EN TYS+S+IEGDAL+D +  +  E K+V++P G +I K+T+K
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YL  HP  Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEY 158

Sequence Alignment: 78. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 138.6 bits 578,  Expect = 7e-35
 Identities = 92/147 62%, Positives = 113/147 76%, Gaps = 1/147 0%
Query  6    HESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKF 65
            +ES+ TSVIP ARLFKAF+L+ DNLIPKV PQAI S+E IEGNGGPGTIKKITF E S F
Sbjct  3    YESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPF 62
Query  66   KYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKG 124
            KY K R+D +D  N  YS+S+IEG AL D +  +  EIK VA+PDGGSI K + KY+TKG
Sbjct  63   KYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKG 122
Query  125  DFQLKEEQIQATIEKITGLSKAVEAYLL 152
            D ++K E+++A  EK   L +AVE+YLL
Sbjct  123  DHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 79. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 138.4 bits 577,  Expect = 9e-35
 Identities = 90/158 56%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++ TSVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+I+   E    L +AVE YLLAH   Y
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 80. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 138.4 bits 577,  Expect = 9e-35
 Identities = 88/158 55%, Positives = 120/158 75%, Gaps = 2/158 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+ES+ TS I PARLFKAFVLD DNL+PK+ PQA++ +E +EGNGG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDAL--TDMVSVSTEIKFVASPDGGSIKKSTT 118
            +   FKY KH+I+A+D E+ TYS+S+IEGDAL    +  ++ E K+VAS DGG++ K+ +
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            KY + GD Q+ EE+++   ++ T + K VEAYL  HP+ Y
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAY 160

Sequence Alignment: 81. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 138.2 bits 576,  Expect = 1e-34
 Identities = 90/157 57%, Positives = 119/157 75%, Gaps = 2/157 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T+E + TSVIPPARL+ AFVLD+DNLIPK+ PQA+KS E +EG+GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S + Y KH+ID +D +N  Y +SVIEGDA+++ +  +S E K+VAS   GS+ KS + 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD ++KEE+++A  EK + L K +E YLL H D Y
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAY 158

Sequence Alignment: 82. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 135.7 bits 565,  Expect = 6e-34
 Identities = 88/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E +  SVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 83. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 135.2 bits 563,  Expect = 8e-34
 Identities = 87/158 55%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E +  SVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++KY K R+D +D  N  YS++VIEGD L D +  V +E+K VA+P GGSI K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 84. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 134.1 bits 558,  Expect = 2e-33
 Identities = 87/157 55%, Positives = 112/157 71%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E +  SVIP ARLFK++VLD D LIPKV PQAI S+E +EGNGGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTKY 120
             S++KY K R+D +D  N TYS++VIEGD L D +  V  E+K VA+P GGSI K ++K+
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            + KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 158

Sequence Alignment: 85. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 133.2 bits 554,  Expect = 3e-33
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH D Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 86. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 133.2 bits 554,  Expect = 3e-33
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 87. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 132.5 bits 551,  Expect = 5e-33
 Identities = 86/158 54%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH D Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEY 159

Sequence Alignment: 88. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 130.9 bits 544,  Expect = 2e-32
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 89. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 130.9 bits 544,  Expect = 2e-32
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 90. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 130.9 bits 544,  Expect = 2e-32
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 91. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 130.7 bits 543,  Expect = 2e-32
 Identities = 84/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGS+ K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 92. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 130.5 bits 542,  Expect = 2e-32
 Identities = 83/156 53%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T++ +  S +PP +L+KAF+LD D L+PKVLP+AIK ++ +EG+G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S  K  K+R+DA+D +N TYS+++IEGD L +   S+S  IK VA PDGGSI K+ + 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPD 156
            Y TKGD ++ EE+I+   EK   + KA+EAYLLA+PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 93. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 130.3 bits 541,  Expect = 2e-32
 Identities = 85/147 57%, Positives = 109/147 74%, Gaps = 1/147 0%
Query  6    HESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKF 65
            +E++ TSVIP ARLFKAF+LD DNL PKV PQAI S++ IEGNGGPGTIKKI F E   F
Sbjct  3    YETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPF 62
Query  66   KYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKG 124
            KY K R+D +D  N  Y++SVIEG  + D +  +S EIK VA+PDGG I K + KY+TKG
Sbjct  63   KYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKG 122
Query  125  DFQLKEEQIQATIEKITGLSKAVEAYLL 152
            + ++K EQ++A+ E    L +AVE+YLL
Sbjct  123  NHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 94. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 130.3 bits 541,  Expect = 3e-32
 Identities = 85/158 53%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 130.0 bits 540,  Expect = 3e-32
 Identities = 85/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E   FK+ K R+D +D  N  YS++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 96. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 129.8 bits 539,  Expect = 3e-32
 Identities = 84/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI  +E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 97. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 129.6 bits 538,  Expect = 4e-32
 Identities = 85/158 53%, Positives = 111/158 70%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  +S++VIEGD L D +  VS E+K VA+P GGSI K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 98. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 129.4 bits 537,  Expect = 5e-32
 Identities = 84/158 53%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E +  SVI  ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S++KY K R+D +D  N  YS++VIEGD L D +  V +E+K VA+P GGS  K ++K
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE YLLAH   Y
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEY 159

Sequence Alignment: 99. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 129.1 bits 536,  Expect = 6e-32
 Identities = 84/157 53%, Positives = 112/157 71%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E++ TSVIP ARLFKAF+LD + LIPKV PQA+ S+E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTKY 120
             S  KY K R++ +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K+
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            + KG  ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 100. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 127.3 bits 528,  Expect = 2e-31
 Identities = 83/158 52%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV  +E++  SV+P ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E S FK+ K R+D +D  N  +S++VIEGD L D +  VS E+  VA+P GGSI K + K
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            ++ KGD ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 159

Sequence Alignment: 101. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 126.9 bits 526,  Expect = 3e-31
 Identities = 83/157 52%, Positives = 110/157 70%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E++  SVIP ARLFK++VLD D LIPKV PQAI S+E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTKY 120
             S FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K+
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            + KG  ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 102. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 126.0 bits 522,  Expect = 5e-31
 Identities = 84/156 53%, Positives = 108/156 69%, Gaps = 0/156 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  T++ +  S I   ++FKAFVLD D +IPK LP+AI  ++ +EG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY 120
            E S  K  KHRID LD EN TYS+S+IEG AL    S+S  IK VA+PDGG I K+ + Y
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPD 156
              K D Q+ EE+I+A  E+ +G+ K VEAYLLA+PD
Sbjct  121  TPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 123.9 bits 513,  Expect = 2e-30
 Identities = 81/157 51%, Positives = 108/157 68%, Gaps = 1/157 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV  +E++  SVIP ARLFK++VLD D LIPKV PQ I S+E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTKY 120
               FK+ K R+D +D  N  Y+++VIEGD L D +  VS E+K VA+P GGSI K ++K+
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            + KG  ++  E+++   E    L +AVE+YLLAH   Y
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEY 158

Sequence Alignment: 104. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 120.3 bits 497,  Expect = 2e-29
 Identities = 78/158 49%, Positives = 113/158 71%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV+T+  + T+ I P RLFKA+VLD DNL+PK+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E    KY KH+I  +D +N    +S+IEGD L + + S++ +IKF A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD  + EE+     E+I  +SKAVEAYLLA+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 105. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 119.0 bits 491,  Expect = 5e-29
 Identities = 78/134 58%, Positives = 102/134 76%, Gaps = 2/134 1%
Query  11   TSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKFKYSKH 70
            TSVIPP +LFKAFVLD+DNLIPK+ PQA+KS+E IEG+GG GT+KKI +GE ++  Y KH
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  71   RIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKGDFQLK 129
            +ID LD  N  YS+S+ EGDAL D +  +S EIK+VAS   GSI K+T+ Y+ KG  ++K
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEQIQATIEKITGLSK 145
            EEQ++   E+  GL K
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 106. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 117.6 bits 485,  Expect = 2e-28
 Identities = 78/155 50%, Positives = 108/155 69%, Gaps = 2/155 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E +  S + PA L+KA+V D+DN+IPK L  + KS+E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  + K+  H+I+++D  N  YS+SV+ G AL D    ++ + K+VA P+GGS  K T K
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPD 156
            Y+TKGD +  +++++    K   L KA+EAYLLAHPD
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD 156

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 116.5 bits 480,  Expect = 4e-28
 Identities = 75/158 47%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV+T   + T+ I P RLFK +VLD D+L+PK+L + +KSIE +EG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E    KY KH+I  +D +N    +S+IEGD L D + S++ ++KF A+ DGG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD  + EE+      K   L KA+EAYLLA+P +Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 108.8 bits 446,  Expect = 7e-26
 Identities = 71/155 45%, Positives = 103/155 66%, Gaps = 1/155 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E Q TS + PA L+KA   D+D + PK LP + KS+E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL +    ++ + K+   P+GGS+ K +  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155
            Y++KGD    E++++A   K   L KAVEAYLLA+P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 108.4 bits 444,  Expect = 1e-25
 Identities = 73/154 47%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV   E   TS +P A+LFKA+ LD D L+P+VLP AIK  E +EG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            +AS +K  K++IDA+D E  T+S+S+I+GD L   + S++  + FV + DGG    ST  
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            + TKGD  + EE I+   ++   + KAVEAYLLA+
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 107.2 bits 439,  Expect = 2e-25
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
            GV T E Q TS + PA L+KA   D+D + PK LP + KS+E +EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
              + K+  H+I+++D  N  YS+S++ G AL +    ++ + K+   P+GGS+ K +  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155
            ++KGD    E++++A   K   L KAVEAYLLA+P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 106.6 bits 436,  Expect = 3e-25
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 2/154 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            M V T E Q TS + PA L+KA+V D+D ++PK +  + KS+E +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  + K+  H+I+ +D  N  YS+S++ G AL D    +S + K+   P+GGS+ K + K
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155
            Y++KGD    E++++A   K   L K +EAYLLA+P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 112. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 106.6 bits 436,  Expect = 3e-25
 Identities = 70/156 44%, Positives = 107/156 68%, Gaps = 3/156 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E + TS +PPA+L+ A + D+D++ PK++   +KS+E +EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  + K+  H+++++D  N  Y++SV+ G AL      ++ E K+V  P+GGSI K T K
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158
            Y+TKGD +  EE+++    K  GL +A+E Y+LA+P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 113. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 103.4 bits 422,  Expect = 3e-24
 Identities = 62/150 41%, Positives = 97/150 64%, Gaps = 1/150 0%
Query  7    ESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKFK 66
            E + TS + P+ +FKAFV+D D + PK  P+  KSI+ IEG+GG GTIK IT+ +   F 
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   YSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTE-IKFVASPDGGSIKKSTTKYQTKGD 125
             SKH++DA+D  N + S+++ EGD L  ++   T  +KF+ S DGGS+ K +  ++ KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  FQLKEEQIQATIEKITGLSKAVEAYLLAHPD 156
             +L +E +    E +    KA+E Y+++HP+
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPE 155

Sequence Alignment: 114. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 103.0 bits 420,  Expect = 4e-24
 Identities = 71/152 46%, Positives = 103/152 67%, Gaps = 3/152 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV T E + TS +PPA+LFKA V+D D L PK++P AI+SIE +EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  K  Y  H+IDA+D    TY +++  G  + +++  VS + K+ A+ DGGS  K +  
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  L +E  Q   +K  G+ KA+E Y+L++
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 115. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 102.2 bits 417,  Expect = 8e-24
 Identities = 64/132 48%, Positives = 95/132 71%, Gaps = 1/132 0%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV+T+  + T+ I P RLFKA+VLD DNL+PK+L Q +K+ E IEG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
            E    KY KH+I  +D +N    +S+IEGD L + + S++ +IKF A+ +GG + K+TT+
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YQTKGDFQLKEEQ 132
            Y+TKGD  + EE+
Sbjct  121  YHTKGDHVVSEEE 133

Sequence Alignment: 116. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 101.1 bits 412,  Expect = 1e-23
 Identities = 69/154 44%, Positives = 100/154 64%, Gaps = 2/154 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            M V T + Q TS + PA L+ A+  D+DN+IPK +  + +S+E +EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E  + K+  H+I+++D  N  YS+S++ G AL D    ++ + K     DGGS+ K T  
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155
            Y+ KGD    E++++A   K   L KAVEAYLLA+P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 117. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 100.2 bits 408,  Expect = 3e-23
 Identities = 69/152 45%, Positives = 100/152 65%, Gaps = 4/152 2%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV     +  S +   ++++ F+LD D + PKVLPQ IKS+E +EG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASP-DGGSIKKSTT 118
            EA+++   K+++D +D     Y+++ I GD L D++ SV  E  FV  P DGG I K+TT
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNE--FVVVPTDGGCIVKNTT 118
Query  119  KYQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
             Y TKGD  L E++I+   EK     KAVEAYLLA+
Sbjct  119  IYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 118. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 98.7 bits 401,  Expect = 8e-23
 Identities = 65/153 42%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV   E +  S +   ++++ F+LD D + PKVLPQ IKS+E +EG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASP-DGGSIKKSTTK 119
            EA+++   K+++D +D     Y+++ I GD L + +  S   +FV  P DGG I K+TT 
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLE-SVVNQFVVVPTDGGCIVKNTTI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            Y TKGD  L E++++   EK     KAVEAYLLA+
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 97.8 bits 397,  Expect = 1e-22
 Identities = 66/153 43%, Positives = 99/153 64%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MGV TH  + TS +   ++F+ FV+D D ++PK  P A KS+E I+G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVE-IKGDGGPGTLKIITLP 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            +         RID ++ E  T+ +SVI+GD L   + S+   + +V + DGGSI K+T  
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+   E+ T L KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 120. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 92.6 bits 374,  Expect = 5e-21
 Identities = 64/153 41%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  +H  + TS +   ++F   VLD D +IPK  P A KS++ ++G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   + S+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+   E+ T L KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 91.9 bits 371,  Expect = 9e-21
 Identities = 64/153 41%, Positives = 94/153 61%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  +H  + TS +   ++F   VLD D +IPK  P A KS+E ++G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S       R DA++ E  TY  +VI+GD L   + S+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 122. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 91.7 bits 370,  Expect = 1e-20
 Identities = 63/153 41%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  +H  + TS +   ++F   VLD D +IPK  P A KS++ ++G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S       R DA++ E  TY  +VI+GD L + + S+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 91.2 bits 368,  Expect = 2e-20
 Identities = 63/153 41%, Positives = 95/153 62%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  +H  + TS +   ++F   VLD D +IPK  P A KS++ ++G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLP 73
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S       R DA++ E  TY  +VI+GD L + + S+ T +  V + DGGSI K+T  
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 124. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 88.7 bits 357,  Expect = 8e-20
 Identities = 62/153 40%, Positives = 93/153 60%, Gaps = 2/153 1%
Query  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
            MG  +H  + TS +   ++F   VLD D +IPK    A KS+E ++G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLP 59
Query  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
            E S       R DA++ E  +Y  +VI+GD L   + S+ T +  V + DGGSI K+T  
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAH 154
            ++TKGD  + EE I+    + T L KA+EAYL+A+
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 67.8 bits 263,  Expect = 5e-14
 Identities = 43/50 86%, Positives = 44/50 88%, Gaps = 0/50 0%
Query  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGP 51
            GV THESQETSVI PARLFKA+ LDSDNLI KVLPQAIKS E IEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 126. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 58.6 bits 223,  Expect = 6e-11
 Identities = 53/98 54%, Positives = 73/98 74%, Gaps = 40/98 40%
Query  22   AFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKFKYSKHRIDALDPENCT 81
            AFVLD+DNLIPK                      KITFGE S++ Y K            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKI 140
                 +EGDAL+D +  +  E K+V++P   +I K+T+KY+TKGD ++KEE+++A  EK 
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  TGLSKAVEAYLLAHPDLY 158
              L K +E YL  HP  Y
Sbjct  82   AHLFKLIEGYLKDHPSEY 99

Sequence Alignment: 127. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 40.9 bits 143,  Expect = 3e-06
 Identities = 23/24 95%, Positives = 23/24 95%, Gaps = 0/24 0%
Query  2    GVSTHESQETSVIPPARLFKAFVL 25
            GV THESQETSVIPPARLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 128. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 43.4 bits 156,  Expect = 4e-06
 Identities = 36/127 28%, Positives = 58/127 45%, Gaps = 4/127 3%
Query  24   VLDSD--NLIPKVLPQAIKSIERIEGNGGPGTIKKITFGEASKFKYSKHRIDALDPENCT 81
            VL  D   ++PKVLP+ +K ++ IEG+GG GTI    F       Y +  I  +D  +  
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YSFSVIEGDALTDMVSV-STEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQATIEKI 140
              + VIEG  L   +S   T  K+    +  ++      Y    D + K    + +   +
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
Query  141  TGLSKAVEAYL 151
              L + +E YL
Sbjct  141  MYLRR-LERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.