The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG
EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI
YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC
Sequence Info Allergen Name Length Opt Bits Score E Value
CAM31908 Act c 8.0101 159 1059 238.7 5.7e-65
CAM31909 Act d 8.0101 157 724 165.7 5.3e-43
O50001 Pru ar 1 160 666 153.1 3.5e-39
CAA96536 Mal d 1.0402 160 636 146.5 3.2e-37
CAA96537 Mal d 1.0403 160 632 145.7 5.9e-37
CAD10374 Cas s 1 160 632 145.7 5.9e-37
ABZ81046 Que a 1.0301 160 631 145.4 6.8e-37
CAA96535 Mal d 1.0401 160 630 145.2 7.9e-37
APD76154 Jug r 5.0101 160 616 142.2 6.6e-36
Q2I6V8 Pru p 1.0101 160 613 141.5 1e-35
AUH28179 Que m 1.0101 160 613 141.5 1e-35
B6CQS9 Pru du 1.0101 160 609 140.6 1.9e-35
O24248 Pru av 1 160 608 140.4 2.2e-35
Q256S2 Fra a 1 160 598 138.3 1e-34
Q256S7 Fra a 1 160 597 138.0 1.2e-34
ACJ23864 Fag s 1.0101 160 597 138.0 1.2e-34
Q3T923 Fra a 1 160 595 137.6 1.6e-34
Q256S6 Fra a 1 160 588 136.1 4.5e-34
ABZ81047 Que a 1.0401 160 586 135.6 6.1e-34
Q256S4 Fra a 1 159 576 133.5 2.7e-33
AAO25113 Mal d 1.0304 159 575 133.2 3.2e-33
AAK13027 Mal d 1.0302 159 570 132.2 6.8e-33
AAK13028 Mal d 1.0303 159 568 131.7 9.2e-33
CAA96549 Cor a 1.0301 160 565 131.1 1.5e-32
CAA58646 Mal d 1.0101 159 561 130.2 2.6e-32
AAK13029 Mal d 1.0109 159 561 130.2 2.6e-32
AAD26546 Mal d 1.0103 159 560 130.0 3.1e-32
CAA50327 Cor a 1.0101 160 560 130.0 3.1e-32
AAD26554 Mal d 1.0106 159 559 129.8 3.6e-32
CAA96534 Mal d 1.0301 159 558 129.5 4.2e-32
AAD29671 Mal d 1.0108 159 558 129.5 4.2e-32
AAD26553 Mal d 1.0105 159 558 129.5 4.2e-32
AAD26552 Mal d 1.0104 159 556 129.1 5.6e-32
AAB01362 Mal d 1.0201 159 555 128.9 6.6e-32
AAD26545 Mal d 1.0202 159 555 128.9 6.6e-32
Q08407 Cor a 1 159 553 128.4 8.9e-32
CAA88833 Mal d 1.0102 159 552 128.2 1e-31
AAD26555 Mal d 1.0107 159 552 128.2 1e-31
AAD26548 Mal d 1.0204 159 551 128.0 1.2e-31
AAD13683 Mal d 1.0206 159 550 127.8 1.4e-31
CAA50325 Cor a 1.0103 160 550 127.8 1.4e-31
CAA50328 Cor a 1.0102 160 550 127.8 1.4e-31
AAG40329 Cor a 1.0402 161 550 127.8 1.4e-31
AAK13030 Mal d 1.0207 159 549 127.6 1.6e-31
AAD26547 Mal d 1.0203 159 549 127.6 1.6e-31
CAA54696.1 Bet v 1.0301 160 549 127.6 1.6e-31
CAD32318 Mal d 1.0208 158 548 127.4 1.9e-31
AAD26558 Mal d 1.0205 159 547 127.1 2.2e-31
AAG40330 Cor a 1.0403 161 547 127.1 2.2e-31
QGS84240 Que i 1.0101 159 542 126.1 4.7e-31
O65200 Pyr c 1 159 542 126.1 4.7e-31
AAD48405 Cor a 1.0401 161 541 125.8 5.5e-31
AAB24432 Aln g 1 160 539 125.4 7.4e-31
CAA96548 Cor a 1.0201 160 539 125.4 7.4e-31
AFN42528 Can s 5.0101 161 539 125.4 7.5e-31
CAB02206 Car b 1.0103 160 538 125.2 8.6e-31
AAG40331 Cor a 1.0404 161 538 125.2 8.7e-31
CAB02207 Car b 1.0104 160 537 125.0 1e-30
ABZ81043 Car b 1.0112 160 536 124.7 1.2e-30
ABZ81040 Car b 1.0109 160 535 124.5 1.4e-30
ABZ81041 Car b 1.0110 160 535 124.5 1.4e-30
QOL10866 Que ac 1.0101 159 534 124.3 1.6e-30
ABZ81045 Que a 1.0201 159 533 124.1 1.8e-30
ADK39021 Ost c 1.0101 160 533 124.1 1.8e-30
P38948 Aln g 1 159 532 123.9 2.1e-30
ABZ81044 Car b 1.0113 160 532 123.9 2.1e-30
ABZ81042 Car b 1.0111 160 531 123.6 2.5e-30
NP_001275580 Sola l 4.0201 160 530 123.4 2.9e-30
CAB02208 Car b 1.0105 160 526 122.6 5.3e-30
Q39427 Bet v 1.0205 160 525 122.3 6.1e-30
CAA50326 Cor a 1.0104 160 524 122.1 7.1e-30
CAB02209 Car b 1.0106 160 524 122.1 7.1e-30
P43186 Bet v 1.0204 160 522 121.7 9.7e-30
CAA54421 Bet v 1.0201 160 522 121.7 9.7e-30
CAA54481 Bet v 1.0202 160 521 121.5 1.1e-29
P43184 Bet v 1.0203 160 521 121.5 1.1e-29
CAB02216 Car b 1.0301 161 521 121.5 1.1e-29
CAB02217 Car b 1.0302 161 521 121.5 1.1e-29
CAA47357 Car b 1.0102 159 518 120.8 1.8e-29
CAB02160 Bet v 1.0113 160 515 120.2 2.8e-29
CAB02213 Car b 1.0107 160 515 120.2 2.8e-29
CAA04828.1 Bet v 1.0206 159 512 119.5 4.3e-29
P38950 Car b 1 159 510 119.1 5.9e-29
CAA54484 Bet v 1.0104 160 509 118.9 6.9e-29
CAB02159 Bet v 1.0112 160 508 118.6 8e-29
CAA33887 Bet v 1.0101 160 508 118.6 8e-29
CAB02156 Bet v 1.0109 160 507 118.4 9.3e-29
CAB02161 Bet v 1.0114 160 506 118.2 1.1e-28
CAA54487 Bet v 1.0106 160 506 118.2 1.1e-28
CAB02215 Car b 1.0108 160 505 118.0 1.3e-28
CAA54483 Bet v 1.0103 160 504 117.8 1.5e-28
CAA04827.1 Bet v 1.0116 159 501 117.1 2.3e-28
CAA54482 Bet v 1.0102 160 501 117.1 2.3e-28
CAA07329.1 Bet v 1.0118 160 501 117.1 2.3e-28
P38949 Car b 1 159 500 116.9 2.7e-28
CAA67246 Pet c PR10 155 497 116.3 4e-28
CAA54489 Bet v 1.0107 160 495 115.8 5.7e-28
CAA07323.1 Bet v 1.0117 160 495 115.8 5.7e-28
CAB02155 Bet v 1.0108 160 494 115.6 6.6e-28
CAB02157 Bet v 1.0110 160 493 115.4 7.7e-28
CAA96547 Bet v 1.0115 160 492 115.1 9e-28
CAA54485 Bet v 1.0105 160 490 114.7 1.2e-27
AAL76932 Dau c 1.0201 154 488 114.3 1.6e-27
CAB02158 Bet v 1.0111 160 486 113.8 2.2e-27
ACF75030.1 Bet v 1.0207 150 484 113.4 2.7e-27
Q0Z8U9 Rub i 1.0101 137 481 112.9 3.8e-27
P92918 Api g 1.0201 159 482 113.0 4e-27
AHC08073 Sola l 4.0101 160 479 112.3 6.4e-27
ABC41615.1 Bet v 1.0119 150 462 108.7 7.6e-26
CAA42646 Gly m 4 158 462 108.6 8.2e-26
AAB92255 Tar o RAP 157 458 107.8 1.5e-25
P49372 Api g 1 154 448 105.6 6.5e-25
CAA43637 Pha v 1 156 448 105.6 6.7e-25
P25985 Pha v 1 155 441 104.1 1.9e-24
BAA13604 Dau c 1.0102 154 437 103.2 3.4e-24
CAB03716 Dau c 1.0104 154 435 102.8 4.7e-24
AAB01092 Dau c 1.0101 168 435 102.7 5.3e-24
CAB06416 Dau c 1.0105 154 430 101.7 9.9e-24
AAQ91847 Ara h 8.0101 157 427 101.0 1.6e-23
CAA75803 Lyc e 4.0101 178 421 99.6 4.8e-23
CAA43636 Pha v 1 155 418 99.0 6.1e-23
CAB03715 Dau c 1.0103 154 416 98.6 8.2e-23
Q2VU97 Vig r 1.0101 155 395 94.0 2e-21
EF436550 Ara h 8.0201 153 390 93.0 4.1e-21
Q5ULZ4 Fra a 1.0101 100 234 59.2 3.8e-11
P85126 Que a 1.0101 50 158 43.1 1.3e-06
Q9ZWP8 Vig r 6.0101 155 147 40.0 3.7e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 238.7 bits 1059,  Expect = 6e-65
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC 159
            YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC 159

Sequence Alignment: 2. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 165.7 bits 724,  Expect = 5e-43
 Identities = 111/157 70%, Positives = 130/157 82%, Gaps = 2/157 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG +TYDMEIPS +   K++KAF+LDGDT++PK LPHAI  V+ LEGDG  GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS HK VK+R+D +DK+N+TYSY+IIEG  L + FESISYHIKIVA PDGG ICKNRSI
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC 159
            YT K D +VSEEEIK GKE+A+ IFK +EAYLLANPD C
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD-C 157

Sequence Alignment: 3. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 153.1 bits 666,  Expect = 3e-39
 Identities = 102/157 64%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP KL+KAFILD D L+PKV P A+K  +ILEGDG  GTIK+VTFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+RVD IDKDNL+YSYT+IEGD L++  E+I+Y IK+VA PDGGSI K  S 
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE++K GKEKAA +FK +EAYLLANPD
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPD 157

Sequence Alignment: 4. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 146.5 bits 636,  Expect = 3e-37
 Identities = 95/157 60%, Positives = 122/157 77%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PK+ P+AIK  KI+EGDG  GTIK+VTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VKQRV+ IDKDN+TYSY++IEGD L++K+E I+Y  K++A PDGGSI K  S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y  KGD ++ EE +K GKEKA+ +FK LEAYLLA+ D
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSD 157

Sequence Alignment: 5. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 145.7 bits 632,  Expect = 6e-37
 Identities = 94/157 59%, Positives = 122/157 77%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PK+ P+AIK  +I+EGDG  GTIK+VTFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VKQRV+ IDKDN+TYSY++IEGD L++K+E I+Y  K++A PDGGSI K  S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y  KGD ++ EE +K GKEKA+ +FK LEAYLLA+ D
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSD 157

Sequence Alignment: 6. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 145.7 bits 632,  Expect = 6e-37
 Identities = 95/157 60%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ EI S +PP +L+KAF+LD D L+PK+ PHAIK  +I+EG+G  GTIK++TFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS+ K VK+R+D ID+ N+TY Y++IEGDV+ E +E ISY IKIVA PDGGSI KN S 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE++  GKEKAA +FKA+EAYLLA+ D
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSD 157

Sequence Alignment: 7. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 145.4 bits 631,  Expect = 7e-37
 Identities = 91/157 57%, Positives = 127/157 80%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP +L+KAF+LD D L+PKV+P+A+K  +I+EG+G  GTIK++TFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH K  K+R+D ID +N+TYS+++IEGD L +K+E++S   KIVA PDGGSI K+ S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++++E I+ GKEKA+E+FKA+EAYL+A+PD
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPD 157

Sequence Alignment: 8. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 145.2 bits 630,  Expect = 8e-37
 Identities = 94/157 59%, Positives = 122/157 77%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PK+ P+AIK  +I+EGDG  GTIK+VTFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VKQRV+ IDKDN+TYSY++IEGD L++K+E I+Y  K++A PDGGSI K  S 
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y  KGD ++ EE +K GKEKA+ +FK LEAYLLA+ D
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSD 157

Sequence Alignment: 9. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 142.2 bits 616,  Expect = 7e-36
 Identities = 91/157 57%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP +L+KAF+LD D L+PKV+P+A+K  +I+EG+G  GTIK++ FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++K VK+R DAID+ N+TY+Y++IEGD LA+K E ISY  KIVA  +GGSI K+ S 
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y +KGD ++ EE++K GKEKA+ +FKA+E YLLA+PD
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPD 157

Sequence Alignment: 10. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 141.5 bits 613,  Expect = 1e-35
 Identities = 90/157 57%, Positives = 121/157 77%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S++PP +L+KAF+LD D LVPK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D+IDK+N +YSYT+IEGD L + +E ISY  K+VA P GGSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +PD
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPD 157

Sequence Alignment: 11. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 141.5 bits 613,  Expect = 1e-35
 Identities = 88/157 56%, Positives = 125/157 79%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGVV Y+ E  S +PP +L+KAF+LD D L+PKV+P+A+K  +I+EG+G  GTIK++TFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH K  K+R+D ID +N+T+S+++IEGD L +K+E++S   KIVA PDGGSI K+   
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++++E I+ GKEKA+ +FKA+EAYL+A+PD
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPD 157

Sequence Alignment: 12. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 140.6 bits 609,  Expect = 2e-35
 Identities = 84/157 53%, Positives = 123/157 78%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG+ TY  E  S +PP +L+KA++L+ DTL+PK+ P+++K  +I+EGDG  GTIK+++FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++D +DKDN+ Y+Y+++EGD L++K E ISY IK+VA  DGGS+ K+ S 
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE++K GKEKA  +FK +E YL+ANPD
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPD 157

Sequence Alignment: 13. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 140.4 bits 608,  Expect = 2e-35
 Identities = 89/157 56%, Positives = 121/157 77%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S++PP +L+KAF+LD D LVPK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D+IDK+N +YSYT+IEGD L + +E ISY  K+VA P GGSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA+ +FK +E YL  +PD
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPD 157

Sequence Alignment: 14. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 138.3 bits 598,  Expect = 1e-34
 Identities = 87/156 55%, Positives = 115/156 73%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+A+KC +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++ +IDK N TYSY++IEGD L+E  E I Y  K+V+ P GG+I K  S 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ EE +K GKEKAA +FK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 156

Sequence Alignment: 15. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 138.0 bits 597,  Expect = 1e-34
 Identities = 86/156 55%, Positives = 116/156 74%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+AIKC +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P GG+I K  S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 16. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 138.0 bits 597,  Expect = 1e-34
 Identities = 90/156 57%, Positives = 121/156 77%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  + + P +L+KAF+LD D L+PKV P+AIK  +I+EG G  GTIK++TFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS+   VK+R+D ID  N+TY+ T+IEGD ++E +E I+Y IK+VA PDGGSI K+ S 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ E++IK GKE+A+ IFKA+EAYLLANP
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156

Sequence Alignment: 17. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 137.6 bits 595,  Expect = 2e-34
 Identities = 84/156 53%, Positives = 116/156 74%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+A+KC +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P GG++ K  S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 18. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 136.1 bits 588,  Expect = 5e-34
 Identities = 85/156 54%, Positives = 115/156 73%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  TY+ E  S +P  KL+KAF+LD D L+PK+ P+AIKC +ILEGDG  GTIK++TFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P GG+I K  S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 19. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 135.6 bits 586,  Expect = 6e-34
 Identities = 87/157 55%, Positives = 123/157 78%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ +  S + P +L+KA+ LD D L+ KVLP+AIK  +I+EG+G  GTIK++TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH K  K+R+D ID +N+TYS+++IEGD L +K+E++S   KIVA PDGGSI K+ S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++++E I+ GKEKA+ +FKA+EAYL+A+PD
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPD 157

Sequence Alignment: 20. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 133.5 bits 576,  Expect = 3e-33
 Identities = 84/155 54%, Positives = 115/155 74%, Gaps = 1/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +P  KL+KAF+LD D L+PK+ P+A+KC +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH+  VK+++ +IDK+N TYSY++IEGD L++  E I Y  K+V+ P G +I K  S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD ++ EE +K GKEKA+ +FK +E YL  +P
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155

Sequence Alignment: 21. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 133.2 bits 575,  Expect = 3e-33
 Identities = 82/156 52%, Positives = 114/156 73%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +  VK+R+D +DK+N+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA+ +FK +E YLL +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPD 156

Sequence Alignment: 22. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 132.2 bits 570,  Expect = 7e-33
 Identities = 82/156 52%, Positives = 113/156 72%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +  VK+R+D +DKDN+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAA-GSGSVIKSTSH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA+ +FK +E YLL + D
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQD 156

Sequence Alignment: 23. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 131.7 bits 568,  Expect = 9e-33
 Identities = 82/156 52%, Positives = 113/156 72%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S +PP +LY AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +  VK+++D +DKDN+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA+ +FK +E YLL + D
Sbjct  120  YHTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHD 156

Sequence Alignment: 24. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 131.1 bits 565,  Expect = 1e-32
 Identities = 84/157 53%, Positives = 117/157 74%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +PP +L+K F+LD D L+PKV P AIK ++I+EG+G  GTIK++ F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +KQ+V+ ID+ N++Y Y++IEGD L++K+E I+Y IKIVA P GGSI K+ S 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y T GD ++ +E+IK GKEKA+ +FKA+E YLLA+ D
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSD 157

Sequence Alignment: 25. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 130.2 bits 561,  Expect = 3e-32
 Identities = 83/156 53%, Positives = 119/156 76%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K+GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 26. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 130.2 bits 561,  Expect = 3e-32
 Identities = 83/156 53%, Positives = 119/156 76%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K+GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 27. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 130.0 bits 560,  Expect = 3e-32
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 28. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 130.0 bits 560,  Expect = 3e-32
 Identities = 82/155 52%, Positives = 117/155 75%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y++E PS +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 29. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 129.8 bits 559,  Expect = 4e-32
 Identities = 83/156 53%, Positives = 119/156 76%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E+ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 30. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 129.5 bits 558,  Expect = 4e-32
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +PP +L+ AF+LD D L+PK+ P+A+K  +ILEGDG  GTIK++ FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +  VK+R+D +DK+N+ Y Y++IEGD ++E  E ISY  K+VA    GS+ K+ S 
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVAS-GSGSVIKSTSH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TK D ++ EE +K GKEKA+ +FK +E YLLA+ D
Sbjct  120  YHTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSD 156

Sequence Alignment: 31. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 129.5 bits 558,  Expect = 4e-32
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 32. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 129.5 bits 558,  Expect = 4e-32
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 33. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 129.1 bits 556,  Expect = 6e-32
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 34. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 128.9 bits 555,  Expect = 7e-32
 Identities = 82/156 52%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 35. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 128.9 bits 555,  Expect = 7e-32
 Identities = 82/156 52%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 36. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 128.4 bits 553,  Expect = 9e-32
 Identities = 81/154 52%, Positives = 116/154 75%, Gaps = 0/154 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y++E PS +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
              KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 37. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 128.2 bits 552,  Expect = 1e-31
 Identities = 81/156 51%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y  KG+ ++ EE +K+GKEK   +FK +E+YL  +PD
Sbjct  120  YHPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPD 156

Sequence Alignment: 38. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 128.2 bits 552,  Expect = 1e-31
 Identities = 82/156 52%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ ++ EE +K GK KA  +FK +E+YL  +PD
Sbjct  120  YHTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 39. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 128.0 bits 551,  Expect = 1e-31
 Identities = 81/156 51%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K++A    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 40. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 127.8 bits 550,  Expect = 1e-31
 Identities = 81/156 51%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+K F+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 41. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 127.8 bits 550,  Expect = 1e-31
 Identities = 82/155 52%, Positives = 115/155 74%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +K VK+RVD +D  N+TYSYT+IEGDVL +K+E + + +KIVA P GGSI K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +++ EEIK  KE A ++++A+E YLLA+
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 42. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 127.8 bits 550,  Expect = 1e-31
 Identities = 81/155 52%, Positives = 115/155 74%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y++E PS +P  +L+K+++LDGD L+PKV P+AI  V+ +EG+G  GTIK +TFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +K VK+RVD +D  N+ YSYT+IEGDVL +K+E +   +KIVA P GGSI K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 43. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 127.8 bits 550,  Expect = 1e-31
 Identities = 88/159 55%, Positives = 114/159 71%, Gaps = 2/159 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV +Y+ E  S +PP +L+K+F+LD D L+PKV P+     + LEG+G  GTIK++TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGG-SICKNRS 119
            EGS  K +K++V+ ID  N+ Y Y+IIEG  L   +E ISY IK+ A P GG SI K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  IYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD-YC 159
             Y TKG+  +SEEEIK GKEKAA +FKA+EAYLLA+PD YC
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC 161

Sequence Alignment: 44. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 127.6 bits 549,  Expect = 2e-31
 Identities = 81/156 51%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GT K++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 45. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 127.6 bits 549,  Expect = 2e-31
 Identities = 81/156 51%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E++L  +PD
Sbjct  120  YHTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPD 156

Sequence Alignment: 46. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 127.6 bits 549,  Expect = 2e-31
 Identities = 85/157 54%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S + P +L+K+F+LD D L+PKV P  +   + +EG+G  GTIK++TF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGSH K +K+RVD ID  N+ Y Y+IIEG  L + +E ISY IKIVA P GGSI K  S 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD  ++EEEIK GKEK A +FKA+E YL+A+P+
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPN 157

Sequence Alignment: 47. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 127.4 bits 548,  Expect = 2e-31
 Identities = 82/155 52%, Positives = 116/155 74%, Gaps = 1/155 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV TY+ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISHY 119
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
             TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPD 155

Sequence Alignment: 48. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 127.1 bits 547,  Expect = 2e-31
 Identities = 81/156 51%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEGDG  GTIK++TFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+++D++D+ N +Y+YT+IEGD L +  E +SY  K+VA    GSI K+ S 
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVAS-GSGSIIKSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +  GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPD 156

Sequence Alignment: 49. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 127.1 bits 547,  Expect = 2e-31
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 2/159 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +PP +L+K+F+LD D L+PKV P+     + LEG+G  GTIK++TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGG-SICKNRS 119
            EGS  K +K++V+ ID  N+ Y Y+IIEG  L   +E ISY IK+ A P GG SI K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  IYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD-YC 159
             Y TKG+  +SEEEIK GKEKAA +FKA+EAYLLA+PD YC
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC 161

Sequence Alignment: 50. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 126.1 bits 542,  Expect = 5e-31
 Identities = 83/156 53%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ +  S +PP +L+KAF+LD D L+PKVLP+AIK ++ +EG+G  GTIK++TFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E S  K  K+R+DA+D +N TYS+++IEGD L +   S+S  IK VA PDGGSI K+ + 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTD-MVSVSTEIKFVASPDGGSIKKSTTK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE+I+   EK   + KA+EAYLLA+PD
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPD 156

Sequence Alignment: 51. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 126.1 bits 542,  Expect = 5e-31
 Identities = 82/156 52%, Positives = 117/156 75%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG+ T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS++  VK+RVD+ID+ + +Y+YT+IEGD L +  E ISY  K+VA   G +I K+ S 
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTI-KSISH 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  120  YHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156

Sequence Alignment: 52. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 125.8 bits 541,  Expect = 6e-31
 Identities = 86/159 54%, Positives = 113/159 71%, Gaps = 2/159 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +PP +L+K+F+LD D L+PKV P+     + LEG+G  GTIK++TF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGG-SICKNRS 119
            EG+  K +K++V+ ID  N+ Y Y+IIEG  L   +E ISY IK+ A P GG SI K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  120  IYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD-YC 159
             Y TKG+  ++EEEIK GKEKAA +FKA+EAYLLA+PD YC
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAYC 161

Sequence Alignment: 53. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 125.4 bits 539,  Expect = 7e-31
 Identities = 81/157 51%, Positives = 115/157 73%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+KAFILDGD L+PKV P A+  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D+ N+ YS+++IEG  + + +E +   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            + TKGD +++ E+IK+ KEKA  ++KA+E+YLLA+ D
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSD 157

Sequence Alignment: 54. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 125.4 bits 539,  Expect = 7e-31
 Identities = 85/157 54%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDG+ L+PKV P+A+  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RV+ +D  N+ YSYT+IEG  + +K E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E IK GKEK   +F+A+EAYLLA+ D
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSD 157

Sequence Alignment: 55. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 125.4 bits 539,  Expect = 7e-31
 Identities = 79/157 50%, Positives = 121/157 77%, Gaps = 1/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY+ E  S + P +L+KAF+LDGD LVPK+ P+A++ V+ILEG+G  GTIK++TFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVL-AEKFESISYHIKIVACPDGGSICKNRS 119
            +G   K VK++++AIDK++LTYSY+IIEGD L   ++E I++  K+VA  DGG++ K  S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  120  IYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
             Y + GD +V+EE++K G+++A +++K +EAYL  +P+
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPE 158

Sequence Alignment: 56. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 125.2 bits 538,  Expect = 9e-31
 Identities = 80/157 50%, Positives = 115/157 73%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            +  KGD +V+ E++K  KE A ++++A+E+YLLA+ D
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTD 157

Sequence Alignment: 57. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 125.2 bits 538,  Expect = 9e-31
 Identities = 85/159 53%, Positives = 113/159 71%, Gaps = 2/159 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV +Y+ E  S +PP +L+K+F+LD D L+PKV P+     + LEG+G  GTIK++TF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGG-SICKNRS 119
            EG+  K +K++V+ ID  N+ Y Y+IIEG  L   +E I Y IK+ A P GG SI K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  120  IYTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD-YC 159
             Y TKG+  ++EEEIK GKEKAA +FKA+EAYLLA+PD YC
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAYC 161

Sequence Alignment: 58. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 125.0 bits 537,  Expect = 1e-30
 Identities = 80/157 50%, Positives = 114/157 72%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL + +E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+ D
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTD 157

Sequence Alignment: 59. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 124.7 bits 536,  Expect = 1e-30
 Identities = 80/155 51%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 60. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 124.5 bits 535,  Expect = 1e-30
 Identities = 80/155 51%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 61. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 124.5 bits 535,  Expect = 1e-30
 Identities = 79/155 50%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGS+ K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 62. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 124.3 bits 534,  Expect = 2e-30
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ +  S +PP +L+KAF+LD D L+ KVLPHA+K  +I+EG+G  GTIK+ TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E S  K  K+R+D +D +N +YS+++IEG+ L +   SIS  +K VA PDGGSI K+ + 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG  ++ EE+I+   EK   +FKA+EAYLLA+PD
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPD 156

Sequence Alignment: 63. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 124.1 bits 533,  Expect = 2e-30
 Identities = 83/156 53%, Positives = 116/156 74%, Gaps = 1/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ +  S + P +L+KA+ LD D L+ KVLP+AIK  +I+EG+G  GTIK++TFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E S  K  K+R+DA+D +N TYS+++IEGD L    ES+S  IK VA PDGGSI K+ + 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALTV-MESVSTEIKCVASPDGGSIMKSTTK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++ EE+I+   EKAA ++KA+EAYL+A+PD
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPD 156

Sequence Alignment: 64. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 124.1 bits 533,  Expect = 2e-30
 Identities = 80/155 51%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 65. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 123.9 bits 532,  Expect = 2e-30
 Identities = 80/156 51%, Positives = 114/156 73%, Gaps = 0/156 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E PS +P  +L+KAFILDGD L+PKV P A+  V+ +EG+G  GTIK++TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS  K VK+RVD +D+ N+ YS+++IEG  + + +E +   IKIVA PDGGSI K  + +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
             TKGD +++ E+IK+ KEKA  ++KA+E+YLLA+ D
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSD 156

Sequence Alignment: 66. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 123.9 bits 532,  Expect = 2e-30
 Identities = 80/155 51%, Positives = 113/155 72%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK+RVD +D  N+ YSYT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 67. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 123.6 bits 531,  Expect = 2e-30
 Identities = 79/155 50%, Positives = 114/155 73%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ E++K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 68. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 123.4 bits 530,  Expect = 3e-30
 Identities = 80/156 51%, Positives = 112/156 71%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T+  E  + + P +L+K ++LD D+LVPK+L H +K ++I+EGDG AG+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K +K+++  ID  NL   Y++IEGDVL +K+ESI+Y +K  A  DGG +CK  + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD  VSEEE  +GK KA ++FKA+EAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156

Sequence Alignment: 69. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 122.6 bits 526,  Expect = 5e-30
 Identities = 79/157 50%, Positives = 114/157 72%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LD D L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            +  KGD +V+ E++K  KE A ++++A+E+YLLA+ D
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTD 157

Sequence Alignment: 70. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 122.3 bits 525,  Expect = 6e-30
 Identities = 82/157 52%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IK+VA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEKA  +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSD 157

Sequence Alignment: 71. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 122.1 bits 524,  Expect = 7e-30
 Identities = 78/155 50%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y++E PS +   +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS +K VK+RVD +D  N+ YSYT+IEGDVL +K+E +   +KIVA P GGS  K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +++ EE+K  KE A ++++A+E YLLA+
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 72. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 122.1 bits 524,  Expect = 7e-30
 Identities = 79/155 50%, Positives = 113/155 72%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LD D L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 73. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 121.7 bits 522,  Expect = 1e-29
 Identities = 82/157 52%, Positives = 110/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157

Sequence Alignment: 74. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 121.7 bits 522,  Expect = 1e-29
 Identities = 82/157 52%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFIL+GDTL+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157

Sequence Alignment: 75. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 121.5 bits 521,  Expect = 1e-29
 Identities = 82/157 52%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFIL+GDTL+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157

Sequence Alignment: 76. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 121.5 bits 521,  Expect = 1e-29
 Identities = 82/157 52%, Positives = 111/157 70%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFIL+GDTL+PKV P+AI  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157

Sequence Alignment: 77. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 121.5 bits 521,  Expect = 1e-29
 Identities = 83/155 53%, Positives = 109/155 70%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDG+ L+PKV P+A+  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RV+ +D  N+ YSYT+IEG  + +K E I   IKIVA PDGGSI K  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            Y TKGD +V  E IK GKE+   ++K +EAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 78. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 121.5 bits 521,  Expect = 1e-29
 Identities = 83/155 53%, Positives = 109/155 70%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDG+ L+PKV P+A+  V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RV+ +D  N+ YSYT+IEG  + +K E I   IKIVA PDGGSI K  S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            Y TKGD +V  E IK GKE+   ++K +EAYLLA+
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 79. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 120.8 bits 518,  Expect = 2e-29
 Identities = 78/154 50%, Positives = 112/154 72%, Gaps = 0/154 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E PS +P  +L+K+++LDGD L+PKV P+AI  V+ + G+G  GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS  K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
              KG  +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 80. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 120.2 bits 515,  Expect = 3e-29
 Identities = 80/157 50%, Positives = 109/157 69%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD LVPKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 81. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 120.2 bits 515,  Expect = 3e-29
 Identities = 78/155 50%, Positives = 111/155 71%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LD D L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ +SYT+IEGDVL +K+E +S  +KIVA P GGSI K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 82. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 119.5 bits 512,  Expect = 4e-29
 Identities = 80/156 51%, Positives = 109/156 69%, Gaps = 0/156 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E  S +P  +L+KAFILDGD L+PKV P+AI  V+ +EG+G  GTIK++TF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS  K VK+RVD +D  N+ YSY++IEG  L + +E I   IK+VA PDGGSI K  + Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
             TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSD 156

Sequence Alignment: 83. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 119.1 bits 510,  Expect = 6e-29
 Identities = 79/154 51%, Positives = 113/154 73%, Gaps = 0/154 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E  S +P  +L+KAFILDG+ L+PKV P+A+  V+ +EG+G  GTIK++TF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            GS  K VK+RV+ ID  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
              KG  +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 84. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 118.9 bits 509,  Expect = 7e-29
 Identities = 80/157 50%, Positives = 109/157 69%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y++E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ YSY++IEG  + + +E IS  IKIVA P+GGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 85. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 118.6 bits 508,  Expect = 8e-29
 Identities = 79/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGGSI K  + 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 86. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 118.6 bits 508,  Expect = 8e-29
 Identities = 79/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 87. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 118.4 bits 507,  Expect = 9e-29
 Identities = 79/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 88. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 118.2 bits 506,  Expect = 1e-28
 Identities = 79/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSD 157

Sequence Alignment: 89. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 118.2 bits 506,  Expect = 1e-28
 Identities = 80/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ YSY++IEG  + + +E IS  IKIVA P+GGSI K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 90. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 118.0 bits 505,  Expect = 1e-28
 Identities = 77/155 49%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E PS +P  +L+K+++LD D L+PKV P+AI  V+ + G+G  GTIK +TF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS  K VK+RVD +D  N+ +SYT+IEGDVL +K+E +S  + IVA P GGSI K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            +  KGD +V+ EE+K  KE A ++++A+E+YLLA+
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 117.8 bits 504,  Expect = 1e-28
 Identities = 80/157 50%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ YSY++IEG  + + +E IS  IKIVA P+GGSI K  + 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 92. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 117.1 bits 501,  Expect = 2e-28
 Identities = 79/156 50%, Positives = 107/156 68%, Gaps = 0/156 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            G   K VK RVD +D  N+ YSY++IEG  + + +E IS  IKIVA PDGGSI K  + Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
             TKGD +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSD 156

Sequence Alignment: 93. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 117.1 bits 501,  Expect = 2e-28
 Identities = 77/157 49%, Positives = 108/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y++E  S +P  +L+KAFILDGD LVPKV P+AI  V+ +EG+G  GTIK++ F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 94. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 117.1 bits 501,  Expect = 2e-28
 Identities = 77/157 49%, Positives = 109/157 69%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L+PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IK+VA PDGGSI +  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD ++  E +K  KEK   +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSD 157

Sequence Alignment: 95. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 116.9 bits 500,  Expect = 3e-28
 Identities = 75/154 48%, Positives = 110/154 71%, Gaps = 0/154 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV  Y+ E PS +P  +L+K+++LDGD L+PKV P+ I  V+ + G+G  GTIK +TF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
            G   K VK+RVD +D  N+ Y+YT+IEGDVL +K+E +S+ +KIVA P GGSI K  S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
              KG  +V+ E++K  KE A ++++A+E+YLLA+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 96. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 116.3 bits 497,  Expect = 4e-28
 Identities = 79/155 50%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV   ++ I S VP  KL+KA+ LD DTL+P+VLP AIK  +ILEGDG  GT+K VT+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            + S +K +KQ++DAIDK+ +T+SY+II+GD+L    +SI+ H+  V   DGG    + ++
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+  ++   IFKA+EAYLLAN
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 97. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 115.8 bits 495,  Expect = 6e-28
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +++KAFILDGD LVPKV P+AI  V+ +EG+G  GTIK++ F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 98. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 115.8 bits 495,  Expect = 6e-28
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 99. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 115.6 bits 494,  Expect = 7e-28
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 100. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 115.4 bits 493,  Expect = 8e-28
 Identities = 76/157 48%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 101. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 115.1 bits 492,  Expect = 9e-28
 Identities = 79/157 50%, Positives = 106/157 67%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +   N+ YSY++IEG  + + +E IS  IKIVA PDG SI K  + 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKGD +V  E+IK  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 102. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 114.7 bits 490,  Expect = 1e-27
 Identities = 75/157 47%, Positives = 107/157 68%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFIL+GD L+PKV P+AI  V+ +EG+G  GTIK++ F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 103. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 114.3 bits 488,  Expect = 2e-27
 Identities = 79/154 51%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV   ++E PS V   K+Y+ F+LD DT+ PKVLP+ IK V+ILEGDG  GT++ V +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E + +  +KQ+VD IDK  L Y+YT I GD+L E +ES+  +  +V   DGG I KN +I
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQF-VVVPTDGGCIVKNTTI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            Y TKGD  + E+++K   EK+A  FKA+EAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 104. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 113.8 bits 486,  Expect = 2e-27
 Identities = 75/157 47%, Positives = 106/157 67%, Gaps = 0/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV  Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK+++F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
             G   K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG + K  + 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157
            Y TKG+ +V  E++K  KE    +++A+E+YLLA+ D
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD 157

Sequence Alignment: 105. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 113.4 bits 484,  Expect = 3e-27
 Identities = 76/148 51%, Positives = 104/148 70%, Gaps = 0/148 0%
Query  6    YDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHH 65
            Y+ E  S +P  +L+KAFIL+GD L+PKV P+AI  V+ +EG+G  GTIK++TF EGS  
Sbjct  3    YESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGSPF 62
Query  66   KCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKG 125
            K VK+RVD +D  N+ YSY++IEG  L + +E I   IKIVA PDGGSI K  + Y TKG
Sbjct  63   KYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKG 122
Query  126  DCKVSEEEIKLGKEKAAEIFKALEAYLL 153
            D ++  E +K  KEK   +++A+E+YLL
Sbjct  123  DHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 106. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 112.9 bits 481,  Expect = 4e-27
 Identities = 71/134 52%, Positives = 99/134 73%, Gaps = 1/134 0%
Query  12   SKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHHKCVKQR 71
            S +PP KL+KAF+LD D L+PK+ P+A+K V+I+EGDG  GT+K++ +GEG+ H  VK++
Sbjct  3    SVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHK 62
Query  72   VDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKGDCKVSE 131
            +D +DK N+ YSY+I EGD L +K E ISY IK+VA    GSI K  S Y  KG  ++ E
Sbjct  63   IDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVAS-GRGSIIKTTSHYHCKGGAEIKE 121
Query  132  EEIKLGKEKAAEIFK 146
            E++K GKE+AA +FK
Sbjct  122  EQVKDGKERAAGLFK 136

Sequence Alignment: 107. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 113.0 bits 482,  Expect = 4e-27
 Identities = 80/154 51%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV    +E PS V   K+Y+ F+LD DT+ PKVLP+ IK V+ILEGDG  GT+K V +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E + +  +KQ+VD IDK  L Y+YT I GD+L + +ES+     +V   DGG I KN +I
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEF-VVVPTDGGCIVKNTTI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            Y TKGD  + E++IK   EK+A  FKA+EAYLLAN
Sbjct  120  YNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 108. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 112.3 bits 479,  Expect = 6e-27
 Identities = 76/156 48%, Positives = 106/156 67%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY  E  + + P +L+KA++LD D LVPK+L + +K  + +EGDG  G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K +K+++  ID  NL   Y++IEGD+L EK+ESI+Y IK  A  +GG + K  + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD  VSEEE  +G+E+   I KA+EAYLLANP
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 108.7 bits 462,  Expect = 8e-26
 Identities = 72/148 48%, Positives = 100/148 67%, Gaps = 0/148 0%
Query  6    YDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHH 65
            Y+ E  S +P  +L+KAFILDGD L PKV P+AI  V+ +EG+G  GTIK++ F EG   
Sbjct  3    YETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGFPF 62
Query  66   KCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKG 125
            K VK RVD +D  N+ Y+Y++IEG  + + +E IS  IKIVA PDGG I K  + Y TKG
Sbjct  63   KYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHTKG 122
Query  126  DCKVSEEEIKLGKEKAAEIFKALEAYLL 153
            + +V  E++K  KE    +++A+E+YLL
Sbjct  123  NHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 110. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 108.6 bits 462,  Expect = 8e-26
 Identities = 74/157 47%, Positives = 108/157 68%, Gaps = 1/157 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ EI S V P  LYKA++ D D ++PK L  + K V+ +EG+G  GTIK++TF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD-SFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E    K V +++++ID+ NL YSY+++ G  L +  E I++  K+VA P+GGS  K    
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDY 158
            Y TKGD + +++E+K GK KA  +FKA+EAYLLA+PDY
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDY 157

Sequence Alignment: 111. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 107.8 bits 458,  Expect = 1e-25
 Identities = 65/153 42%, Positives = 101/153 66%, Gaps = 0/153 0%
Query  7    DMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHHK 66
            + EI S + P  ++KAF++D DT+ PK  P   K +K +EGDG  GTIK +T+ +G    
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  67   CVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKGD 126
              K++VDAID +N++ SYTI EGDVL    ES ++H+K +   DGGS+ K+  ++  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  127  CKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC 159
             K+++E + L KE   + FKA+E Y++++P+ C
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHPEAC 157

Sequence Alignment: 112. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 105.6 bits 448,  Expect = 7e-25
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T+ +E+ S V   K+++ F++D DT++PK  P A K V+I +GDG  GT+K +T+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            +G     +  R+D ++K+ LT+ Y++I+GD+L    ESI  H+ +V   DGGSICK  +I
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK   E+   +FKALEAYL+AN
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 113. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 105.6 bits 448,  Expect = 7e-25
 Identities = 72/156 46%, Positives = 103/156 66%, Gaps = 0/156 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ +  S V P  LYKA   D DT+ PK LP + K V+I+EG+G  GTIK+++F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E    K V +++++ID+ NL YSY+I+ G  L E  E I++  K+   P+GGS+ K    
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y +KGD   +E+E+K GK K+  +FKA+EAYLLANP
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 114. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 104.1 bits 441,  Expect = 2e-24
 Identities = 71/155 45%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
            GV T++ +  S V P  LYKA   D DT+ PK LP + K V+I+EG+G  GTIK+++F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
                K V +++++ID+ NL YSY+I+ G  L E  E I++  K+   P+GGS+ K    Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
             +KGD   +E+E+K GK K+  +FKA+EAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 115. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 103.2 bits 437,  Expect = 3e-24
 Identities = 70/154 45%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  ++ +EI S V   K++   +LD DT++PK  P A K V + +GDG AGT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +  R DA++K+ LTY  T+I+GD+L E  ESI  H+ +V   DGGSI K  +I
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 116. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 102.8 bits 435,  Expect = 5e-24
 Identities = 70/154 45%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  ++ +EI S V   K++   +LD DT++PK  P A K V + +GDG AGT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +  R DA++K+ LTY  T+I+GD+L    ESI  H+ +V   DGGSI K  +I
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+  E+   +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 117. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 102.7 bits 435,  Expect = 5e-24
 Identities = 70/154 45%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  ++ +EI S V   K++   +LD DT++PK  P A K V + +GDG AGT++ +T+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +  R DA++K+ LTY  T+I+GD+L E  ESI  H+ +V   DGGSI K  +I
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 118. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 101.7 bits 430,  Expect = 1e-23
 Identities = 69/154 44%, Positives = 100/154 64%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  ++ +EI S V   K++   +LD DT++PK  P A K V++ +GDG AGT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +  R DA++K+ LTY  T+I+GD+L    ESI  H+ +V   DGGSI K  +I
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 119. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 101.0 bits 427,  Expect = 2e-23
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 2/154 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ EI S VPP KLY A + D D++ PK++   +K V+I+EG+G  GTIK++T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E    K + ++V++ID+ N  Y+Y+++ G  L    E I++  K+V  P+GGSI K    
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y TKGD K  EEE+K GK K   +F+A+E Y+LANP
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154

Sequence Alignment: 120. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 99.6 bits 421,  Expect = 5e-23
 Identities = 67/158 42%, Positives = 101/158 63%, Gaps = 1/158 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV TY  E  + + P +L+KA++LD D LVPK+L + +K  + +EGDG  G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EG   K +K+++  ID  NL   Y++IEGD+L EK+ESI+Y IK  A  +GG + K  + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC 159
            Y TKGD  VSEEE  +G+ +  E F+   + + +   +C
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQGCRS-IPSRESFC 158

Sequence Alignment: 121. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 99.0 bits 418,  Expect = 6e-23
 Identities = 69/155 44%, Positives = 101/155 65%, Gaps = 1/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            M V T++ +  S V P  LYKA++ D DT+VPK +  + K V+I+EG+G  GTIK+++F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD-SFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E    K V ++++ ID+ NL YSY+I+ G  L +  E IS   K+   P+GGS+ K    
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y +KGD   +E+E+K GK K+  +FK +EAYLLANP
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 122. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 98.6 bits 416,  Expect = 8e-23
 Identities = 67/154 43%, Positives = 99/154 64%, Gaps = 1/154 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MG  ++ +EI S V   K++   +LD DT++PK    A K V++ +GDG AGT++ +T+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            EGS    +  R DA++K+ L+Y  T+I+GD+L    ESI  H+ +V   DGGSI K  +I
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  V EE IK+   +   +FKA+EAYL+AN
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 94.0 bits 395,  Expect = 2e-21
 Identities = 66/155 42%, Positives = 98/155 63%, Gaps = 1/155 0%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            M V T+D +  S V P  LY A+  D D ++PK +  + + V+I+EG+G  GTIK+++F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E    K V ++++++D+ NL YSY+I+ G  L +  E I+   KI    DGGS+ K    
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156
            Y  KGD   +E+E+K GK K+  +FKA+EAYLLANP
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 124. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 93.0 bits 390,  Expect = 4e-21
 Identities = 68/153 44%, Positives = 100/153 65%, Gaps = 2/153 1%
Query  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
            MGV T++ E  S VPP KL+KA ++DGD L PK++P AI+ ++I+EG+G  GT+K+VT  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
            E      V +++DAID+   TY YTI  G  + E +E +S+  K+ A  DGGS  K    
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAA-DGGSKIKVSVT 118
Query  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLAN 155
            + TKGD  + +E  +  K+K+  IFKA+E Y+L+N
Sbjct  119  FHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 59.2 bits 234,  Expect = 4e-11
 Identities = 49/96 51%, Positives = 67/96 69%, Gaps = 39/96 40%
Query  22   AFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHHKCVKQRVDAIDKDNLT 81
            AF+LD D L+P                      K++TFGEGS+                 
Sbjct  1    AFVLDADNLIP----------------------KKITFGEGSQ----------------- 21
Query  82   YSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGKEKA 141
            Y Y  +EGD L++ +E I Y  K+V+ P   +I K  S Y TKGD ++ EE +K GKEKA
Sbjct  22   YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  142  AEIFKALEAYLLANP 156
            A +FK +E YL  +P
Sbjct  82   AHLFKLIEGYLKDHP 96

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 43.1 bits 158,  Expect = 1e-06
 Identities = 23/48 47%, Positives = 35/48 72%, Gaps = 0/48 0%
Query  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDG 49
            GV T++ +  S + P +L+KA+ LD D L+ KVLP+AIK  +I+EG+G
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNG 48

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 40.0 bits 147,  Expect = 4e-05
 Identities = 37/127 29%, Positives = 61/127 48%, Gaps = 9/127 7%
Query  19   LYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGEGSHHKCVKQRVDAIDKD 78
            L K FI    T+VPKVLPH +K V+++EGDG  GTI    F         ++ +   D+ 
Sbjct  22   LSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDES 77
Query  79   NLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKLGK 138
            +      +IEG  L + +       K+    +  ++   +  Y    D    EE++   K
Sbjct  78   SHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDI---EEKVTPTK 134
Query  139  EKAAEI--FKALEAYL 152
               + +  ++ LE YL
Sbjct  135  TSQSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.