The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD26552 Mal d 1.0104 159 1035 317.3 1.3e-88
AAD29671 Mal d 1.0108 159 1020 312.8 2.9e-87
CAA58646 Mal d 1.0101 159 1015 311.3 8.2e-87
AAD26554 Mal d 1.0106 159 1014 311.0 1e-86
AAD26546 Mal d 1.0103 159 1011 310.1 1.9e-86
AAD26553 Mal d 1.0105 159 1009 309.5 2.9e-86
AAD26555 Mal d 1.0107 159 1008 309.2 3.6e-86
AAK13029 Mal d 1.0109 159 1004 307.9 8.2e-86
O65200 Pyr c 1 159 992 304.3 1e-84
CAA88833 Mal d 1.0102 159 991 304.0 1.2e-84
AAB01362 Mal d 1.0201 159 975 299.2 3.5e-83
AAD26545 Mal d 1.0202 159 975 299.2 3.5e-83
AAD26548 Mal d 1.0204 159 971 298.0 8.2e-83
AAD13683 Mal d 1.0206 159 970 297.7 1e-82
AAK13030 Mal d 1.0207 159 969 297.4 1.2e-82
AAD26547 Mal d 1.0203 159 969 297.4 1.2e-82
AAD26558 Mal d 1.0205 159 967 296.8 1.9e-82
CAD32318 Mal d 1.0208 158 965 296.2 2.8e-82
O24248 Pru av 1 160 892 274.1 1.2e-75
Q2I6V8 Pru p 1.0101 160 876 269.3 3.5e-74
Q256S4 Fra a 1 159 825 253.9 1.5e-69
Q256S7 Fra a 1 160 818 251.8 6.5e-69
AAO25113 Mal d 1.0304 159 817 251.5 7.9e-69
Q3T923 Fra a 1 160 817 251.5 8e-69
Q256S2 Fra a 1 160 811 249.7 2.8e-68
Q256S6 Fra a 1 160 809 249.1 4.3e-68
AAK13027 Mal d 1.0302 159 805 247.9 9.7e-68
AAK13028 Mal d 1.0303 159 792 244.0 1.5e-66
CAA96534 Mal d 1.0301 159 788 242.8 3.4e-66
APD76154 Jug r 5.0101 160 780 240.4 1.8e-65
O50001 Pru ar 1 160 765 235.8 4.2e-64
CAA96535 Mal d 1.0401 160 761 234.6 9.8e-64
CAA96536 Mal d 1.0402 160 760 234.3 1.2e-63
CAA96537 Mal d 1.0403 160 757 233.4 2.3e-63
B6CQS9 Pru du 1.0101 160 739 228.0 9.7e-62
CAD10374 Cas s 1 160 733 226.2 3.4e-61
ACJ23864 Fag s 1.0101 160 713 220.1 2.2e-59
CAA96549 Cor a 1.0301 160 686 212.0 6.3e-57
CAA54696.1 Bet v 1.0301 160 679 209.9 2.7e-56
AAG40329 Cor a 1.0402 161 671 207.5 1.5e-55
AAD48405 Cor a 1.0401 161 671 207.5 1.5e-55
AAG40331 Cor a 1.0404 161 668 206.6 2.8e-55
AAG40330 Cor a 1.0403 161 668 206.6 2.8e-55
AFN42528 Can s 5.0101 161 660 204.1 1.5e-54
ABZ81046 Que a 1.0301 160 650 201.1 1.2e-53
Q0Z8U9 Rub i 1.0101 137 644 199.5 3.2e-53
Q39427 Bet v 1.0205 160 645 199.6 3.4e-53
AUH28179 Que m 1.0101 160 643 199.0 5.1e-53
P43186 Bet v 1.0204 160 638 197.5 1.5e-52
CAA04828.1 Bet v 1.0206 159 632 195.7 5e-52
CAA54481 Bet v 1.0202 160 626 193.9 1.8e-51
P43184 Bet v 1.0203 160 625 193.6 2.2e-51
CAA54421 Bet v 1.0201 160 624 193.3 2.7e-51
CAA96548 Cor a 1.0201 160 623 193.0 3.3e-51
ABZ81047 Que a 1.0401 160 622 192.7 4.1e-51
QOL10866 Que ac 1.0101 159 617 191.2 1.2e-50
CAA07329.1 Bet v 1.0118 160 613 190.0 2.7e-50
QGS84240 Que i 1.0101 159 603 187.0 2.2e-49
CAA04827.1 Bet v 1.0116 159 602 186.7 2.7e-49
CAB02160 Bet v 1.0113 160 602 186.6 2.7e-49
CAA07323.1 Bet v 1.0117 160 598 185.4 6.2e-49
CAA33887 Bet v 1.0101 160 597 185.1 7.7e-49
CAB02155 Bet v 1.0108 160 597 185.1 7.7e-49
CAB02159 Bet v 1.0112 160 597 185.1 7.7e-49
CAA54487 Bet v 1.0106 160 596 184.8 9.5e-49
CAA54482 Bet v 1.0102 160 596 184.8 9.5e-49
CAB02156 Bet v 1.0109 160 596 184.8 9.5e-49
CAA54483 Bet v 1.0103 160 595 184.5 1.2e-48
CAA54485 Bet v 1.0105 160 595 184.5 1.2e-48
CAB02161 Bet v 1.0114 160 595 184.5 1.2e-48
CAA54484 Bet v 1.0104 160 593 183.9 1.8e-48
ABZ81045 Que a 1.0201 159 592 183.6 2.2e-48
CAB02157 Bet v 1.0110 160 592 183.6 2.2e-48
CAA50325 Cor a 1.0103 160 591 183.3 2.7e-48
CAB02217 Car b 1.0302 161 591 183.3 2.7e-48
CAA54489 Bet v 1.0107 160 590 183.0 3.3e-48
CAB02158 Bet v 1.0111 160 589 182.7 4.1e-48
CAA96547 Bet v 1.0115 160 588 182.4 5e-48
AAB24432 Aln g 1 160 587 182.1 6.2e-48
ACF75030.1 Bet v 1.0207 150 580 180.1 2.4e-47
P38948 Aln g 1 159 580 180.0 2.7e-47
CAA50327 Cor a 1.0101 160 580 180.0 2.7e-47
CAB02216 Car b 1.0301 161 578 179.4 4.1e-47
CAB02207 Car b 1.0104 160 576 178.8 6.2e-47
CAB02206 Car b 1.0103 160 575 178.5 7.7e-47
CAA50328 Cor a 1.0102 160 574 178.2 9.4e-47
Q08407 Cor a 1 159 573 177.9 1.2e-46
CAB02208 Car b 1.0105 160 572 177.6 1.4e-46
ABZ81041 Car b 1.0110 160 566 175.8 5e-46
ADK39021 Ost c 1.0101 160 565 175.5 6.2e-46
ABZ81043 Car b 1.0112 160 565 175.5 6.2e-46
ABZ81042 Car b 1.0111 160 565 175.5 6.2e-46
ABZ81040 Car b 1.0109 160 563 174.9 9.4e-46
CAB02209 Car b 1.0106 160 562 174.6 1.2e-45
ABZ81044 Car b 1.0113 160 561 174.3 1.4e-45
P38950 Car b 1 159 560 174.0 1.7e-45
CAA50326 Cor a 1.0104 160 560 174.0 1.8e-45
CAM31908 Act c 8.0101 159 556 172.8 4e-45
CAA47357 Car b 1.0102 159 554 172.2 6.1e-45
CAB02213 Car b 1.0107 160 552 171.6 9.4e-45
CAB02215 Car b 1.0108 160 542 168.5 7.6e-44
P38949 Car b 1 159 541 168.2 9.3e-44
ABC41615.1 Bet v 1.0119 150 540 168.0 1e-43
CAA42646 Gly m 4 158 517 161.0 1.4e-41
CAM31909 Act d 8.0101 157 497 155.0 9e-40
AAQ91847 Ara h 8.0101 157 496 154.7 1.1e-39
EF436550 Ara h 8.0201 153 493 153.8 2e-39
CAA43637 Pha v 1 156 486 151.7 8.9e-39
CAA43636 Pha v 1 155 480 149.9 3.1e-38
P25985 Pha v 1 155 479 149.6 3.8e-38
NP_001275580 Sola l 4.0201 160 476 148.6 7.5e-38
Q2VU97 Vig r 1.0101 155 460 143.8 2e-36
AHC08073 Sola l 4.0101 160 450 140.8 1.7e-35
CAA75803 Lyc e 4.0101 178 418 131.0 1.7e-32
CAA67246 Pet c PR10 155 404 126.9 2.5e-31
P92918 Api g 1.0201 159 396 124.5 1.4e-30
AAL76932 Dau c 1.0201 154 390 122.7 4.6e-30
AAB92255 Tar o RAP 157 384 120.9 1.7e-29
P49372 Api g 1 154 372 117.3 2e-28
Q5ULZ4 Fra a 1.0101 100 357 113.2 2.2e-27
CAB03716 Dau c 1.0104 154 342 108.2 1e-25
CAB06416 Dau c 1.0105 154 339 107.3 2e-25
BAA13604 Dau c 1.0102 154 337 106.7 3e-25
AAB01092 Dau c 1.0101 168 335 106.0 5.2e-25
CAB03715 Dau c 1.0103 154 330 104.6 1.3e-24
P85126 Que a 1.0101 50 218 71.9 3e-15
Q9ZWP8 Vig r 6.0101 155 158 52.7 5.4e-09
Q9S8Q4 Cas s 1 24 108 39.4 8.6e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 317.3 bits 1035,  Expect = 1e-88
 Identities = 159/159 100%, Positives = 159/159 100%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 2. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 312.8 bits 1020,  Expect = 3e-87
 Identities = 157/159 98%, Positives = 158/159 99%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 3. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 311.3 bits 1015,  Expect = 8e-87
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVK GKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 4. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 311.0 bits 1014,  Expect = 1e-86
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIE ISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 5. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 310.1 bits 1011,  Expect = 2e-86
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 6. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 309.5 bits 1009,  Expect = 3e-86
 Identities = 156/159 98%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 7. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 309.2 bits 1008,  Expect = 4e-86
 Identities = 156/159 98%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVKAGK KAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 8. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 307.9 bits 1004,  Expect = 8e-86
 Identities = 155/159 97%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKGNIEIKEEHVK GKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 9. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 304.3 bits 992,  Expect = 1e-84
 Identities = 151/159 94%, Positives = 157/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG+YTFENE+TSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEGNGGPGTIKKITFG
Sbjct  1    MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHR+DSIDEASYSY+YTLIEGDALTDTIEKISYE KLVA GSGSTIKSISHY
Sbjct  61   EGSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+IEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159

Sequence Alignment: 10. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 304.0 bits 991,  Expect = 1e-84
 Identities = 152/159 95%, Positives = 154/159 96%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENE+TSEIPP RLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG
Sbjct  1    MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG+TIKSISHY
Sbjct  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KGNIEIKEEHVK GKEK HGLFKLIESYLK HPDAYN
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 11. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 299.2 bits 975,  Expect = 4e-83
 Identities = 147/159 92%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 12. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 299.2 bits 975,  Expect = 4e-83
 Identities = 147/159 92%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 13. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 298.0 bits 971,  Expect = 8e-83
 Identities = 146/159 91%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKL+A GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLMASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 14. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 297.7 bits 970,  Expect = 1e-82
 Identities = 146/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFK FVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 15. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 297.4 bits 969,  Expect = 1e-82
 Identities = 146/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGT KKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 16. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 297.4 bits 969,  Expect = 1e-82
 Identities = 146/159 91%, Positives = 156/159 98%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKAHGLFKLIES+LK HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHPDAYN 159

Sequence Alignment: 17. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 296.8 bits 967,  Expect = 2e-82
 Identities = 146/159 91%, Positives = 155/159 97%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHY
Sbjct  61   EGSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHV AGKEKAHGLFKLIESYLK HPDAYN
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHPDAYN 159

Sequence Alignment: 18. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 296.2 bits 965,  Expect = 3e-82
 Identities = 145/158 91%, Positives = 155/158 98%, Gaps = 0/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GVYT+ENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIK+AEILEG+GGPGTIKKITFGE
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYH 121
            GSQYGYVKH+IDS+DEA+YSY+YTLIEGDALTDTIEK+SYETKLVA GSGS IKSISHYH
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH 120
Query  122  TKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            TKG++EI EEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Sbjct  121  TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 158

Sequence Alignment: 19. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 274.1 bits 892,  Expect = 1e-75
 Identities = 136/159 85%, Positives = 150/159 94%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGSQYGYVKH+IDSID+ +YSYSYTLIEGDAL DT+EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN+EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  121  YHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 20. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 269.3 bits 876,  Expect = 4e-74
 Identities = 133/159 83%, Positives = 149/159 93%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E+TSEIPPPRLFKAFVLDADNL+PKIAPQAIK++EILEG+GGPGTIKKITFG
Sbjct  1    MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGSQYGYVKH+IDSID+ ++SYSYTLIEGDAL D +EKISYETKLVA  SG S IKS SH
Sbjct  61   EGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE+YLK HPDAYN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN 160

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 253.9 bits 825,  Expect = 1e-69
 Identities = 123/159 77%, Positives = 142/159 89%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G+ IK+ S Y
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGTIIKTTSKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 159

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 251.8 bits 818,  Expect = 6e-69
 Identities = 125/159 78%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQAIK AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 23. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 251.5 bits 817,  Expect = 8e-69
 Identities = 122/159 76%, Positives = 141/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +HPDAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHPDAYN 159

Sequence Alignment: 24. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 251.5 bits 817,  Expect = 8e-69
 Identities = 124/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGST-IKSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G T IK+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 25. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 249.7 bits 811,  Expect = 3e-68
 Identities = 123/159 77%, Positives = 142/159 89%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVYT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQA+K AEILEG+GGPGTIKKITFG
Sbjct  1    MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL++ IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 249.1 bits 809,  Expect = 4e-68
 Identities = 124/159 77%, Positives = 141/159 88%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG YT+ENE+TS+IP P+LFKAFVLDADNLIPKIAPQAIK AEILEG+GGPGTIKKITFG
Sbjct  1    MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+YGYVKH+I SID+ +++YSY+LIEGDAL+D IEKI YETKLV+   G TI K+ S 
Sbjct  61   EGSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEEHVKAGKEKA  LFKLIE YLKDHP  YN
Sbjct  121  YHTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHPSEYN 160

Sequence Alignment: 27. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 247.9 bits 805,  Expect = 1e-67
 Identities = 121/159 76%, Positives = 140/159 88%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLVAAGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHQDAYN 159

Sequence Alignment: 28. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 244.0 bits 792,  Expect = 1e-66
 Identities = 119/159 74%, Positives = 139/159 87%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E E+TS IPP RL+ AFVLDADNLIPKIAPQA+K  EILEG+GG GTIKKI FG
Sbjct  1    MGVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKH+ID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKSISHY
Sbjct  61   EGSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLVASGSGSVIKSISHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG++EIKEEHVKAGKEKA  LFKLIE+YL +H DAYN
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHHDAYN 159

Sequence Alignment: 29. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 242.8 bits 788,  Expect = 3e-66
 Identities = 119/159 74%, Positives = 136/159 85%, Gaps = 0/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E+TS IPP RLF AFVLDADNLIPKIAPQA+K AEILEG+GG GTIKKI FG
Sbjct  1    MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            EGS Y YVKHRID +D+ ++ Y Y++IEGDA+++TIEKISYETKLVA GSGS IKS SHY
Sbjct  61   EGSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLVASGSGSVIKSTSHY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTK ++EIKEEHVKAGKEKA  LFKLIE+YL  H DAYN
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAHSDAYN 159

Sequence Alignment: 30. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 240.4 bits 780,  Expect = 2e-65
 Identities = 118/159 74%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E E TS IPP RLFKAFVLDADNLIPK+ PQA+K +EI+EGNGGPGTIKKI FG
Sbjct  1    MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQY YVKHR D+IDEA+++Y+Y++IEGDAL D IEKISYETK+VA   G +I KSISH
Sbjct  61   EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH+KG+ EIKEE VK GKEKA GLFK +E YL  HPDAYN
Sbjct  121  YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN 160

Sequence Alignment: 31. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 235.8 bits 765,  Expect = 4e-64
 Identities = 114/159 71%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E E+TS IPP +LFKAF+LDADNLIPK+AP A+K  EILEG+GG GTIKK+TFG
Sbjct  1    MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQY YVKHR+D ID+ + SYSYTLIEGDAL+D IE I+Y+ KLVA    GS +K+ SH
Sbjct  61   EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEE+VKAGKEKA GLFKL+E+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDAYN 160

Sequence Alignment: 32. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 234.6 bits 761,  Expect = 1e-63
 Identities = 112/159 70%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 33. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 234.3 bits 760,  Expect = 1e-63
 Identities = 111/159 69%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E+TS IP PRLFKAF+LD DNLIPKIAPQAIK  +I+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YH KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 34. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 233.4 bits 757,  Expect = 2e-63
 Identities = 111/159 69%, Positives = 136/159 85%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E+TS IP PRLFKAF+LD DNLIPKIAPQAIK  EI+EG+GG GTIKK+TFG
Sbjct  1    MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGSQYGYVK+R++ ID+ +++YSY++IEGD L+D +EKI+YETKL+A    GS IK+ SH
Sbjct  61   EGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSH 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y  KG++EIKEEHVKAGKEKA GLFKL+E+YL  H DAYN
Sbjct  121  YRAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN 160

Sequence Alignment: 35. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 228.0 bits 739,  Expect = 1e-61
 Identities = 111/159 69%, Positives = 138/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG++T+ +E TS IPPPRLFKA+VL+AD LIPKIAPQ++K AEI+EG+GG GTIKKI+FG
Sbjct  1    MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSG-STIKSISH 119
            EGS+Y YVKH+ID +D+ ++ Y+Y+L+EGDAL+D +EKISYE KLVA   G S IKS S+
Sbjct  61   EGSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSN 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG++EIKEE VKAGKEKA GLFKLIE+YL  +PDAYN
Sbjct  121  YHTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANPDAYN 160

Sequence Alignment: 36. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 226.2 bits 733,  Expect = 3e-61
 Identities = 113/159 71%, Positives = 132/159 83%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T ENE TS IPP RLFKAFVLDADNLIPK+AP+AIK AEI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQ+ YVKHRID ID+A+++Y Y++IEGD + + +EKISYE K+VA   G +I K+ S 
Sbjct  61   EGSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG  EIKEE V AGKEKA GLFK +E+YL  H DAYN
Sbjct  121  YHTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAHSDAYN 160

Sequence Alignment: 37. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 220.1 bits 713,  Expect = 2e-59
 Identities = 108/159 67%, Positives = 137/159 86%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E T+ I P RLFKAFVLDADNLIPK+APQAIK +EI+EG+GGPGTIKKITFG
Sbjct  1    MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGSQ+ YVKHRID ID A+++Y+ TLIEGDA+++T+EKI+YE KLVA   G +I KS S 
Sbjct  61   EGSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ EIKE+++KAGKE+A G+FK +E+YL  +P AY+
Sbjct  121  YHTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANPAAYH 160

Sequence Alignment: 38. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 212.0 bits 686,  Expect = 6e-57
 Identities = 102/159 64%, Positives = 130/159 81%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IPP RLFK FVLD+DNLIPK+AP+AIK  EI+EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFD 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS + Y+K++++ ID+A++SY Y++IEGDAL+D +EKI+YE K+VA   G +I KSIS 
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHT G+ E+K+E++KAGKEKA GLFK +E YL  H DAYN
Sbjct  121  YHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN 160

Sequence Alignment: 39. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 209.9 bits 679,  Expect = 3e-56
 Identities = 101/159 63%, Positives = 126/159 79%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS I P RLFK+FVLDADNLIPK+AP+ +  AE +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS++ Y+KHR+D ID A++ Y Y++IEG  L DT+EKISYE K+VA  G GS +K  S 
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+I + EE +KAGKEK  GLFK +E+YL  HP+AYN
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN 160

Sequence Alignment: 40. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 207.5 bits 671,  Expect = 1e-55
 Identities = 101/158 63%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+++E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EGS++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 41. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 207.5 bits 671,  Expect = 1e-55
 Identities = 101/158 63%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EG+++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 42. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 206.6 bits 668,  Expect = 3e-55
 Identities = 100/158 63%, Positives = 123/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+++E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EG+++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKI YE K+ A   G GS +K  S
Sbjct  61   EGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPDAY
Sbjct  121  KYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAY 160

Sequence Alignment: 43. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 206.6 bits 668,  Expect = 3e-55
 Identities = 101/158 63%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IPP RLFK+FVLDADNLIPK+APQ    AE LEGNGGPGTIKKITF 
Sbjct  1    MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC--GSGSTIKSIS 118
            EGS++ Y+KH+++ ID A++ Y Y++IEG  L  T+EKISYE K+ A   G GS +K  S
Sbjct  61   EGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
             YHTKGN  I EE +KAGKEKA GLFK +E+YL  HPD Y
Sbjct  121  KYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTY 160

Sequence Alignment: 44. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 204.1 bits 660,  Expect = 1e-54
 Identities = 96/159 60%, Positives = 134/159 84%, Gaps = 2/159 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E+TS I P RLFKAFVLD DNL+PKIAPQA+++ EILEGNGG GTIKKITFG
Sbjct  1    MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALT-DTIEKISYETKLVACGSG-STIKSIS 118
            +G  + YVKH+I++ID+ S +YSY++IEGDAL  + +EKI++E+KLVA G G + IK++S
Sbjct  61   QGVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  HYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
             Y++ G+ ++ EE VK G+++A  ++K +E+YLKDHP+AYN
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHPEAYN 161

Sequence Alignment: 45. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 201.1 bits 650,  Expect = 1e-53
 Identities = 96/158 60%, Positives = 125/158 79%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T+E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA    GS +KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA  +FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHPDLY 159

Sequence Alignment: 46. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 199.5 bits 644,  Expect = 3e-53
 Identities = 95/137 69%, Positives = 115/137 83%, Gaps = 0/137 0%
Query  10   YTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVK 69
            YTS IPPP+LFKAFVLDADNLIPKIAPQA+K  EI+EG+GG GT+KKI +GEG+++ YVK
Sbjct  1    YTSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVK 60
Query  70   HRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIK 129
            H+ID +D+ ++ YSY++ EGDAL D IEKISYE KLVA G GS IK+ SHYH KG  EIK
Sbjct  61   HKIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLVASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EEHVKAGKEKAHGLFKL 146
            EE+VK GKE+A GLFK+
Sbjct  121  EEQVKDGKERAAGLFKI 137

Sequence Alignment: 47. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 199.6 bits 645,  Expect = 3e-53
 Identities = 100/159 62%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E KLVA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEKA  L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 48. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 199.0 bits 643,  Expect = 5e-53
 Identities = 94/158 59%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV  +E+E  S IPP RLFKAFVLD+DNLIPK+ PQA+K  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+  + KHRID ID  ++++S+++IEGDAL D +E +S ETK+VA    GS +KS   
Sbjct  61   EGSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDGY 159

Sequence Alignment: 49. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 197.5 bits 638,  Expect = 1e-52
 Identities = 98/159 61%, Positives = 121/159 76%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 50. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 195.7 bits 632,  Expect = 5e-52
 Identities = 98/158 62%, Positives = 120/158 75%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E+E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            GS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E KLVA   G +I  IS+ Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 51. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 193.9 bits 626,  Expect = 2e-51
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 52. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 193.6 bits 625,  Expect = 2e-51
 Identities = 96/159 60%, Positives = 120/159 75%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 53. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 193.3 bits 624,  Expect = 3e-51
 Identities = 96/159 60%, Positives = 119/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+L+ D LIPK+APQAI   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 54. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 193.0 bits 623,  Expect = 3e-51
 Identities = 92/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD +NLIPK+APQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKEK  GLF+ +E+YL  H DAYN
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN 160

Sequence Alignment: 55. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 192.7 bits 622,  Expect = 4e-51
 Identities = 94/158 59%, Positives = 123/158 77%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS+  + KHRID ID  +++YS+++IEGDAL D +E +S ETK+VA   G +I KS S 
Sbjct  61   EGSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++ +E ++ GKEKA G+FK +E+YL  HPD Y
Sbjct  121  YQTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHPDLY 159

Sequence Alignment: 56. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 191.2 bits 617,  Expect = 1e-50
 Identities = 95/158 60%, Positives = 122/158 77%, Gaps = 2/158 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGVY +E++ TS IPP RLFKAFVLD+DNLI K+ P+A+K  EI+EGNGGPGTIKK TFG
Sbjct  1    MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            E S+  Y KHRID++D  + SYS+++IEG+ALTD I  IS E K+VA   G +I KS + 
Sbjct  61   EASKVKYAKHRIDTLDPENCSYSFSVIEGEALTD-IASISTEVKFVASPDGGSIMKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y+TKG  ++KEE+++A  EK  GLFK +E+YL  HPD YN
Sbjct  120  YQTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHPDLYN 159

Sequence Alignment: 57. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 190.0 bits 613,  Expect = 3e-50
 Identities = 94/159 59%, Positives = 118/159 74%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNLIPK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E KLVA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K EH+KA KEK   L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAHSDAYN 160

Sequence Alignment: 58. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 187.0 bits 603,  Expect = 2e-49
 Identities = 94/157 59%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T E++ TS IPP RLFKAFVLD+DNLIPK+ PQAIK  E +EGNGGPGTIKKITFG
Sbjct  1    MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIK-SISH 119
            E S++ Y KHRID++D  + +YS+++IEGDALTD +  +S E K+VA   G +IK S + 
Sbjct  61   EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++KEE+++A  EK  GL K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLY 158

Sequence Alignment: 59. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 186.7 bits 602,  Expect = 3e-49
 Identities = 93/158 58%, Positives = 116/158 73%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            G  + YVK R+D +D A++ YSY+LIEG  + DT+EKIS E K+VA   G +I  IS+ Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 159

Sequence Alignment: 60. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 186.6 bits 602,  Expect = 3e-49
 Identities = 91/159 57%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 61. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 185.4 bits 598,  Expect = 6e-49
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 62. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 185.1 bits 597,  Expect = 8e-49
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 63. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 185.1 bits 597,  Expect = 8e-49
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 64. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 185.1 bits 597,  Expect = 8e-49
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 65. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 184.8 bits 596,  Expect = 9e-49
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 66. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 184.8 bits 596,  Expect = 9e-49
 Identities = 91/159 57%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 67. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 184.8 bits 596,  Expect = 9e-49
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 68. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 184.5 bits 595,  Expect = 1e-48
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 69. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 184.5 bits 595,  Expect = 1e-48
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E+E TS IP  RLFKAF+L+ DNLIPK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 70. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 184.5 bits 595,  Expect = 1e-48
 Identities = 91/159 57%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 71. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 183.9 bits 593,  Expect = 2e-48
 Identities = 90/159 56%, Positives = 117/159 73%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ YSY++IEG  + DT+EKIS E K+VA  +G +I  I++ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 72. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 183.6 bits 592,  Expect = 2e-48
 Identities = 92/157 58%, Positives = 122/157 77%, Gaps = 2/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGPGTIKKITFG
Sbjct  1    MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            E S++ Y KHRID++D  + +YS+++IEGDALT  +E +S E K VA   G +I KS + 
Sbjct  61   EASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            Y+TKG+ ++KEE+++A  EKA GL+K +E+YL  HPD Y
Sbjct  120  YQTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHPDLY 158

Sequence Alignment: 73. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 183.6 bits 592,  Expect = 2e-48
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + D +EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 74. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 183.3 bits 591,  Expect = 3e-48
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 75. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 183.3 bits 591,  Expect = 3e-48
 Identities = 89/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD +NLIPK+APQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSI-SH 119
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  I S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 76. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 183.0 bits 590,  Expect = 3e-48
 Identities = 89/159 55%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  R+FKAF+LD D L+PK+APQAI   E +EGNGGPGTIKKI F 
Sbjct  1    MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 77. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 182.7 bits 589,  Expect = 4e-48
 Identities = 90/159 56%, Positives = 114/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
             G  + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  +  IS+ 
Sbjct  61   GGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKGN E+K E+VKA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 78. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 182.4 bits 588,  Expect = 5e-48
 Identities = 90/159 56%, Positives = 115/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD DNL PK+APQAI   E +EGNGGPGTIKKI+F 
Sbjct  1    MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EG  + YVK R+D +   ++ YSY++IEG  + DT+EKIS E K+VA   G +I  IS+ 
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+K E++KA KE    L++ +ESYL  H DAYN
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN 160

Sequence Alignment: 79. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 182.1 bits 587,  Expect = 6e-48
 Identities = 88/159 55%, Positives = 116/159 72%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            EGS + YVK R+D +D  ++ YS+++IEG A+ D +EK+  E K+VA   G +I  IS+ 
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +HTKG+ EI  E++K  KEKA GL+K +ESYL  H DAYN
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 160

Sequence Alignment: 80. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 180.1 bits 580,  Expect = 2e-47
 Identities = 89/148 60%, Positives = 113/148 76%, Gaps = 1/148 0%
Query  4    YTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGS 63
            + +E+E TS IP  RLFKAF+L+ DNLIPK+APQAI   E +EGNGGPGTIKKITF EGS
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  64   QYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-YHT 122
             + YVK R+D +D A++ YSY++IEG AL DT+EKI  E K+VA   G +I  IS+ YHT
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            KG+ E+K EH+KA KEK   L++ +ESYL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 81. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 180.0 bits 580,  Expect = 3e-47
 Identities = 87/158 55%, Positives = 115/158 72%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFKAF+LD D L+PK+AP+A+   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-Y 120
            GS + YVK R+D +D  ++ YS+++IEG A+ D +EK+  E K+VA   G +I  IS+ +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            HTKG+ EI  E++K  KEKA GL+K +ESYL  H DAYN
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN 159

Sequence Alignment: 82. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 180.0 bits 580,  Expect = 3e-47
 Identities = 88/159 55%, Positives = 113/159 71%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 83. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 179.4 bits 578,  Expect = 4e-47
 Identities = 87/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF 
Sbjct  1    MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFS 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSI-SH 119
            EGS   YVK R++ +D  ++ YSYT+IEG  + D +EKI  E K+VA   G +I  I S 
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            YHTKG+ E+  EH+K GKE+  GL+K +E+YL  H   YN
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTAEYN 160

Sequence Alignment: 84. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 178.8 bits 576,  Expect = 6e-47
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 85. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 178.5 bits 575,  Expect = 8e-47
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 86. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 178.2 bits 574,  Expect = 9e-47
 Identities = 88/159 55%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GS +K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 87. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 177.9 bits 573,  Expect = 1e-46
 Identities = 87/158 55%, Positives = 112/158 70%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E +EGNGGPGTIK ITFGE
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS+Y YVK R+D +D  +++YSYT+IEGD L D +EK+ +E K+VA  G GS +K  S +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 159

Sequence Alignment: 88. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 177.6 bits 572,  Expect = 1e-46
 Identities = 86/159 54%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H D YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTDEYN 160

Sequence Alignment: 89. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 175.8 bits 566,  Expect = 5e-46
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 90. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 175.5 bits 565,  Expect = 6e-46
 Identities = 85/159 53%, Positives = 112/159 70%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI + E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 91. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 175.5 bits 565,  Expect = 6e-46
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 92. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 175.5 bits 565,  Expect = 6e-46
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 93. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 174.9 bits 563,  Expect = 9e-46
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 94. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 174.6 bits 562,  Expect = 1e-45
 Identities = 85/159 53%, Positives = 111/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 95. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 174.3 bits 561,  Expect = 1e-45
 Identities = 85/159 53%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EG  + +VK R+D +D A++ YSYT+IEGD L D +EK+S+E K+VA  G GS +K  S 
Sbjct  61   EGIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 96. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 174.0 bits 560,  Expect = 2e-45
 Identities = 85/158 53%, Positives = 110/158 69%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E TS IP  RLFKAF+LD + LIPK++PQA+   E +EGNGGPGTIKKITF E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS   YVK R++ ID  ++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 97. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 174.0 bits 560,  Expect = 2e-45
 Identities = 87/159 54%, Positives = 110/159 69%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S I   RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITFG
Sbjct  1    MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS+Y YVK R+D +D  ++ YSYT+IEGD L D +EK+  E K+VA  G GST+K  S 
Sbjct  61   EGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ EI  E +K  KE A  L++ +E+YL  H   YN
Sbjct  121  FHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN 160

Sequence Alignment: 98. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 172.8 bits 556,  Expect = 4e-45
 Identities = 83/156 53%, Positives = 118/156 75%, Gaps = 1/156 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T++ E  S++PP +L+KAF+LD D L+PK+ P+AIK  +ILEG+G  GTIK++TFG
Sbjct  1    MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS++  VK+R+D+ID+ + +YSYT+IEGD L +  E ISY  K+VAC  G +I K+ S 
Sbjct  61   EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156
            Y TKG+ ++ EE +K GKEKA  +FK +E+YL  +PD
Sbjct  121  YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPD 157

Sequence Alignment: 99. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 172.2 bits 554,  Expect = 6e-45
 Identities = 84/158 53%, Positives = 109/158 68%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            GS + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 100. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 171.6 bits 552,  Expect = 9e-45
 Identities = 84/159 52%, Positives = 109/159 68%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S IP  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E K+VA  G GS +K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 101. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 168.5 bits 542,  Expect = 8e-44
 Identities = 82/159 51%, Positives = 108/159 67%, Gaps = 1/159 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+ +E E  S +P  RLFK++VLD D LIPK+APQAI   E + GNGGPGTIK ITF 
Sbjct  1    MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISH 119
            EGS + +VK R+D +D A++ +SYT+IEGD L D +EK+S E  +VA  G GS +K    
Sbjct  61   EGSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGK 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            +H KG+ E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN 160

Sequence Alignment: 102. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 168.2 bits 541,  Expect = 9e-44
 Identities = 82/158 51%, Positives = 107/158 67%, Gaps = 1/158 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+ +E E  S IP  RLFK++VLD D LIPK+APQ I   E + GNGGPGTIK ITF E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVAC-GSGSTIKSISHY 120
            G  + +VK R+D +D A++ Y+YT+IEGD L D +EK+S+E K+VA  G GS +K  S +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            H KG  E+  E +K  KE A  L++ +ESYL  H   YN
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN 159

Sequence Alignment: 103. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 168.0 bits 540,  Expect = 1e-43
 Identities = 83/148 56%, Positives = 106/148 71%, Gaps = 1/148 0%
Query  4    YTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGS 63
            + +E E TS IP  RLFKAF+LD DNL PK+APQAI   + +EGNGGPGTIKKI F EG 
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  64   QYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH-YHT 122
             + YVK R+D +D  ++ Y+Y++IEG  + DT+EKIS E K+VA   G  I  IS+ YHT
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            KGN E+K E+VKA KE    L++ +ESYL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 104. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 161.0 bits 517,  Expect = 1e-41
 Identities = 84/157 53%, Positives = 113/157 71%, Gaps = 3/157 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE+E  S + P  L+KA+V DADN+IPK A  + K  E +EGNGGPGTIKKITF 
Sbjct  1    MGVFTFEDEINSPVAPATLYKALVTDADNVIPK-ALDSFKSVENVEGNGGPGTIKKITFL 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+SIDEA+  YSY+++ G AL DT EKI++++KLVA  +G +   ++  
Sbjct  60   EDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAYN 159
            Y TKG+ E  ++ +K GK KA  LFK IE+YL  HPD YN
Sbjct  120  YETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPD-YN 158

Sequence Alignment: 105. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 155.0 bits 497,  Expect = 9e-40
 Identities = 80/155 51%, Positives = 107/155 69%, Gaps = 2/155 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  T++ E  S I   ++FKAFVLD D +IPK  P+AI   + LEG+GG GTIK  TFG
Sbjct  1    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS +  VKHRID +D+ +++YSY++IEG AL D  E ISY  K+VA   G  I K+ S 
Sbjct  61   EGSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPD 156
            Y  K + ++ EE +KAGKE+A G+FK +E+YL  +PD
Sbjct  120  YTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPD 156

Sequence Alignment: 106. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 154.7 bits 496,  Expect = 1e-39
 Identities = 77/156 49%, Positives = 112/156 71%, Gaps = 3/156 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE+E TS +PP +L+ A + DAD++ PKI    +K  EI+EGNGGPGTIKK+T  
Sbjct  1    MGVFTFEDEITSTVPPAKLYNA-MKDADSITPKIIDD-VKSVEIVEGNGGPGTIKKLTIV 58
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  ++ H+++SIDEA+Y+Y+Y+++ G AL  T EKI++ETKLV   +G +I  ++  
Sbjct  59   EDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLK 118
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+ +  EE +K GK K  GLF+ IE Y+  +P  Y
Sbjct  119  YHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY 157

Sequence Alignment: 107. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 153.8 bits 493,  Expect = 2e-39
 Identities = 76/150 50%, Positives = 107/150 71%, Gaps = 1/150 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE E TS +PP +LFKA V+D D L PK+ P AI+  EI+EGNGGPGT+KK+T  
Sbjct  1    MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E  +  YV H+ID+IDEA+Y+Y YT+  G  + + +EK+S++TKL A   GS IK    +
Sbjct  60   EDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTF 119
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            HTKG+  + +E  +  K+K++G+FK IE Y+
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYV 150

Sequence Alignment: 108. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 151.7 bits 486,  Expect = 9e-39
 Identities = 74/155 47%, Positives = 108/155 69%, Gaps = 1/155 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  
Sbjct  61   EDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSIT 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 109. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 149.9 bits 480,  Expect = 3e-38
 Identities = 76/154 49%, Positives = 109/154 70%, Gaps = 2/154 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V+TFE++ TS + P  L+KA+V DAD ++PK A  + K  EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFEDQTTSPVAPATLYKALVKDADTIVPK-AVDSFKSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-H 119
            E  +  +V H+I+ IDEA+  YSY+++ G AL DT EKIS ++KL    +G ++  +S  
Sbjct  60   EDGETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIK 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH+KG+    E+ +KAGK K+  LFK+IE+YL  +P
Sbjct  120  YHSKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 149.6 bits 479,  Expect = 4e-38
 Identities = 73/154 47%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 111. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 148.6 bits 476,  Expect = 8e-38
 Identities = 75/158 47%, Positives = 104/158 65%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV TF +E T+ I P RLFK +VLD D+L+PK+  + +K  EI+EG+GG G+IK++ F 
Sbjct  1    MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L D +E I+Y+ K+ A G G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+  + EE    GK KA  LFK IE+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANPSVY 159

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 143.8 bits 460,  Expect = 2e-36
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 2/154 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V+TF+++ TS + P  L+ A+  DADN+IPK A  + +  EI+EGNGGPGTIKKI+F 
Sbjct  1    MAVFTFDDQATSPVAPATLYNALAKDADNIIPK-AVGSFQSVEIVEGNGGPGTIKKISFV 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISH 119
            E  +  +V H+I+S+DEA+  YSY+++ G AL DT EKI+ +TK+      GS IK    
Sbjct  60   EDGETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTIS 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155
            YH KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  YHGKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 140.8 bits 450,  Expect = 2e-35
 Identities = 69/158 43%, Positives = 102/158 64%, Gaps = 1/158 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDAY 158
            YHTKG+  + EE    G+E+   + K +E+YL  +P  Y
Sbjct  121  YHTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANPSVY 159

Sequence Alignment: 114. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 131.0 bits 418,  Expect = 2e-32
 Identities = 64/145 44%, Positives = 94/145 64%, Gaps = 1/145 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T+  E T+ I P RLFKA+VLD DNL+PK+  Q +K  E +EG+GG G+IK++ F 
Sbjct  1    MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EG    Y+KH+I  ID+ +    Y+LIEGD L + +E I+Y+ K+ A  +G  + K+ + 
Sbjct  61   EGGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTE 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFK 145
            YHTKG+  + EE    G+ + H  F+
Sbjct  121  YHTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 126.9 bits 404,  Expect = 2e-31
 Identities = 62/151 41%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV   E   TS +P  +LFKA+ LD D L+P++ P AIK  EILEG+GG GT+K +T+G
Sbjct  1    MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGS-TIKSISH 119
            + S Y  +K++ID+ID+ ++++SY++I+GD L   I+ I+    +V    G  T  S + 
Sbjct  61   DASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAV 120
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            ++TKG+  + EE++K   ++ + +FK +E+YL
Sbjct  121  FNTKGDAVVPEENIKFANDQNNLIFKAVEAYL 152

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 124.5 bits 396,  Expect = 1e-30
 Identities = 59/151 39%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV     E  S +   ++++ F+LD D + PK+ PQ IK  EILEG+GG GT+K + +G
Sbjct  1    MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E ++Y  +K+++D ID+A  +Y+YT I GD L D +E +  E  +V    G  +K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +TKG+  + E+ +K   EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKIKEATEKSALAFKAVEAYL 151

Sequence Alignment: 117. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 122.7 bits 390,  Expect = 5e-30
 Identities = 58/151 38%, Positives = 94/151 62%, Gaps = 0/151 0%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV   E E  S +   ++++ F+LD D + PK+ PQ IK  EILEG+GG GT++ + +G
Sbjct  1    MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLG 60
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHY 120
            E ++Y  +K+++D ID+A   Y+YT I GD L + +E +  +  +V    G  +K+ + Y
Sbjct  61   EATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTIY 120
Query  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +TKG+  + E+ VK   EK+   FK +E+YL
Sbjct  121  NTKGDAVLPEDKVKEATEKSALAFKAVEAYL 151

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 120.9 bits 384,  Expect = 2e-29
 Identities = 61/155 39%, Positives = 93/155 60%, Gaps = 3/155 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            M V  FE   TS + P  +FKAFV+D D + PK  P+  K  + +EG+GG GTIK IT+ 
Sbjct  1    MAVAEFE--ITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYS 58
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISH- 119
            +G  +   KH++D+ID  ++S SYT+ EGD L   IE  ++  K++    G ++   S  
Sbjct  59   DGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMV 118
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDA 157
            +  KG+ ++ +E+V   KE     FK IE+Y+  HP+A
Sbjct  119  FKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEA 156

Sequence Alignment: 119. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 117.3 bits 372,  Expect = 2e-28
 Identities = 60/150 40%, Positives = 93/150 62%, Gaps = 2/150 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MGV T   E TS +   ++F+ FV+D D ++PK AP A K  EI +G+GGPGT+K IT+ 
Sbjct  1    MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            +G     +  RID +++ + ++ Y++I+GD L   IE I     LV    G +I K+ + 
Sbjct  60   DGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K   E+   LFK +E+YL
Sbjct  120  FHTKGDAVVPEENIKYANEQNTALFKALEAYL 151

Sequence Alignment: 120. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 113.2 bits 357,  Expect = 2e-27
 Identities = 81/99 81%, Positives = 88/99 88%, Gaps = 40/99 40%
Query  22   AFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYS 81
            AFVLDADNLIPK                      KITFGEGSQYGYVK            
Sbjct  1    AFVLDADNLIPK----------------------KITFGEGSQYGYVK------------ 26
Query  82   YSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKAGKEKA 140
                 +EGDAL+DT+EKI YETKLV+  S STI K+ S YHTKG++EIKEEHVKAGKEKA
Sbjct  27   -----VEGDALSDTLEKIDYETKLVSAPSSSTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 81
Query  141  HGLFKLIESYLKDHPDAYN 159
              LFKLIE YLKDHP  YN
Sbjct  82   AHLFKLIEGYLKDHPSEYN 100

Sequence Alignment: 121. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 108.2 bits 342,  Expect = 1e-25
 Identities = 60/148 40%, Positives = 91/148 61%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGS---GSTIKSI 117
            EGS    +  R D++++ + +Y  T+I+GD L   IE I  ET LV   +   GS  K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            + +HTKG+  + EE++K   E+   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADEQNTALFKAIEAYL 151

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 107.3 bits 339,  Expect = 2e-25
 Identities = 60/148 40%, Positives = 90/148 60%, Gaps = 6/148 4%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGS---GSTIKSI 117
            EGS    +  R D++++ + +Y  T+I+GD L   IE I  ET LV   +   GS  K+ 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESI--ETHLVVVPTADGGSITKTT 117
Query  118  SHYHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            + +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  118  AIFHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 123. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 106.7 bits 337,  Expect = 3e-25
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  60   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 124. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 106.0 bits 335,  Expect = 5e-25
 Identities = 56/150 37%, Positives = 89/150 59%, Gaps = 2/150 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK AP A K  ++ +G+GG GT++ IT+ 
Sbjct  15   MGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGGAGTVRIITLP 73
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + +Y  T+I+GD L + IE I     +V    G +I K+ + 
Sbjct  74   EGSPITSMTVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAI 133
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  134  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 165

Sequence Alignment: 125. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 104.6 bits 330,  Expect = 1e-24
 Identities = 57/150 38%, Positives = 87/150 58%, Gaps = 2/150 1%
Query  1    MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFG 60
            MG  +   E TS +   ++F   VLD D +IPK A  A K  E+ +G+GG GT++ IT+ 
Sbjct  1    MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGGAGTVRIITLP 59
Query  61   EGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTI-KSISH 119
            EGS    +  R D++++ + SY  T+I+GD L   IE I     +V    G +I K+ + 
Sbjct  60   EGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAI 119
Query  120  YHTKGNIEIKEEHVKAGKEKAHGLFKLIESYL 151
            +HTKG+  + EE++K    +   LFK IE+YL
Sbjct  120  FHTKGDAVVPEENIKFADAQNTALFKAIEAYL 151

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 71.9 bits 218,  Expect = 3e-15
 Identities = 33/50 66%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 52.7 bits 158,  Expect = 5e-09
 Identities = 37/129 28%, Positives = 58/129 44%, Gaps = 4/129 3%
Query  24   VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYS 81
            VL  D   ++PK+ P+ +K  +++EG+GG GTI    F       Y +  I   DE+S+ 
Sbjct  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
Query  82   YSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTKGNIEIKEEHVKAGKEKA 140
                +IEG  L   +       KL       T+ ++   Y    +IE K    K  +   
Sbjct  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
Query  141  HGLFKLIESYLKD 153
              L +L E YL +
Sbjct  141  MYLRRL-ERYLSN 152

Sequence Alignment: 128. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 39.4 bits 108,  Expect = 9e-06
 Identities = 17/24 70%, Positives = 20/24 83%, Gaps = 0/24 0%
Query  2    GVYTFENEYTSEIPPPRLFKAFVL 25
            GV+T E++ TS IPP RLFKAFVL
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.