The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG
TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS
LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ
GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA
STDEVAK
Sequence Info Allergen Name Length Opt Bits Score E Value
P12670 Lyc e NP24 247 1812 408.2 1.3e-115
CAC34055 Cap a 1w 246 1613 364.2 2.3e-102
Q9ARG0 Cap a 1.0101 246 1613 364.2 2.3e-102
AAG34078 Cap a 1 180 1190 270.7 2.3e-74
P81370 Act c 2 225 1089 248.4 1.5e-67
1Z3Q_A Mus a 4.0101 200 1081 246.6 4.6e-67
E3SU11 Ole e 13.0101 226 1037 236.9 4.5e-64
P81295 Jun a 3 225 791 182.5 1.1e-47
AAR21074 Cup s 3.0102 225 781 180.3 4.9e-47
AAR21073 Cup s 3.0101 225 781 180.3 4.9e-47
CAC05258 Cup a 3 199 767 177.2 3.6e-46
AAF80165 Jun v 3.010102 97 383 92.4 5.9e-21
AAF80167 Jun v 3.010101 97 383 92.4 5.9e-21
CAC10270 Mal d 2 246 254 63.7 6.4e-12
P50694 Pru av 2 245 244 61.5 3e-11
ACE80955 Pru p 2.0301 242 238 60.2 7.3e-11
ACE80959 Pru p 2.0101 246 238 60.2 7.5e-11
ACE80957 Pru p 2.0201 246 236 59.8 1e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 408.2 bits 1812,  Expect = 1e-115
 Identities = 247/247 100%, Positives = 247/247 100%, Gaps = 0/247 0%
Query  1    MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG 60
            MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG
Sbjct  1    MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG 60
Query  61   TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS 120
            TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS
Sbjct  61   TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA 240
            GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA 240
Query  241  STDEVAK 247
            STDEVAK
Sbjct  241  STDEVAK 247

Sequence Alignment: 2. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 364.2 bits 1613,  Expect = 2e-102
 Identities = 218/246 88%, Positives = 229/246 93%, Gaps = 1/246 0%
Query  1    MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG 60
            MGYL SSFVLF+L  VTYTYAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW INAP G
Sbjct  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
Query  61   TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS 120
            T MARIWGRT CNF+ +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF+NLDFWDIS
Sbjct  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPT PSGGKCHAI+CTANINGECP +L+VPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA 240
            GPCGPTELSKFFKKRCPDAYSYPQDD TSTFTCP GSTNYRVVFCPNGV  PNFPLEMP 
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
Query  241  STDEVAK 247
            S D VAK
Sbjct  241  S-DGVAK 246

Sequence Alignment: 3. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 364.2 bits 1613,  Expect = 2e-102
 Identities = 218/246 88%, Positives = 229/246 93%, Gaps = 1/246 0%
Query  1    MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRG 60
            MGYL SSFVLF+L  VTYTYAAT EVRNNCPYTVWAASTP+GGGRRL+RGQTW INAP G
Sbjct  1    MGYLRSSFVLFLLAFVTYTYAATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPG 60
Query  61   TKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDIS 120
            T MARIWGRT CNF+ +GRG+CQTGDCGGVLQCTGWGKPPNTLAEYAL+QF+NLDFWDIS
Sbjct  61   TAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDIS 120
Query  121  LVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQ 180
            LVDGFNIPMTFAPT PSGGKCHAI+CTANINGECP +L+VPGGCNNPCTTFGGQQYCCTQ
Sbjct  121  LVDGFNIPMTFAPTNPSGGKCHAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQ 180
Query  181  GPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPA 240
            GPCGPTELSKFFKKRCPDAYSYPQDD TSTFTCP GSTNYRVVFCPNGV  PNFPLEMP 
Sbjct  181  GPCGPTELSKFFKKRCPDAYSYPQDDATSTFTCPSGSTNYRVVFCPNGVTGPNFPLEMPG 240
Query  241  STDEVAK 247
            S D VAK
Sbjct  241  S-DGVAK 246

Sequence Alignment: 4. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 270.7 bits 1190,  Expect = 2e-74
 Identities = 149/180 82%, Positives = 165/180 91%, Gaps = 0/180 0%
Query  28   NNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDC 87
            NNCPYTVWAA+TP+GGG+RL RGQ+W   AP GTKMARIWGRT CNF+ AGRG CQTGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  88   GGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCT 147
            GGVL+C GWGKPPNTLAEYAL+QFSNLDFWDIS++DGFNIPM+F PTKP  GKCH I+C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  148  ANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDP 207
            ANINGECP +L+VPGGCNNPCTTFGGQQYCCTQGPCGPT+LS+FFK+RCPDAYSYPQDDP
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDDP 180

Sequence Alignment: 5. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 248.4 bits 1089,  Expect = 2e-67
 Identities = 147/219 67%, Positives = 172/219 78%, Gaps = 4/219 1%
Query  4    LTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKM 63
            L+ S +LF  +  T    AT  + NNCP+TVWAA+ P GGG+RL+RGQ W+IN   GTK 
Sbjct  7    LSLSALLFIAFLFTCARGATFNIINNCPFTVWAAAVP-GGGKRLDRGQNWIINPGAGTKG 65
Query  64   ARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVD 123
            AR+W RTGCNF+ AGRG CQTGDC G+LQC  +G+PPNTLAEYAL+QF+NLDF+DISLVD
Sbjct  66   ARVWPRTGCNFDGAGRGKCQTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVD 125
Query  124  GFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPC 183
            GFN+ M F+PT  SGG    I CTA+ING+CP  L+ PGGCNNPCT F   QYCC  G C
Sbjct  126  GFNVAMEFSPT--SGGCTRGIKCTADINGQCPNELRAPGGCNNPCTVFKTDQYCCNSGNC 183
Query  184  GPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
            G T +SKFFK RCPDAYSYP+DD TSTFTCP G TNY+VVFCP
Sbjct  184  GLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAG-TNYKVVFCP 225

Sequence Alignment: 6. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 246.6 bits 1081,  Expect = 5e-67
 Identities = 143/200 71%, Positives = 165/200 82%, Gaps = 5/200 2%
Query  22   ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGT 81
            AT E+ N C YTVWAA+ P GGGR+LN+GQ+W IN   GT   RIWGRTGC+F+ +GRG 
Sbjct  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR 59
Query  82   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKC 141
            CQTGDCGGVL CT +G PPNTLAE+AL+QF+NLDF+DISLVDGFN+PM F+PT  SGG C
Sbjct  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT--SGG-C 116
Query  142  HAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYS 201
              I C A+ING+CP ALK PGGCNNPCT F   QYCC  G C PT+ S+FFK+ CPDAYS
Sbjct  117  RGIRCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYS 176
Query  202  YPQDDPTSTFTCPGGSTNYRVVFCP 226
            YP+DD T+TFTCPGG TNYRVVFCP
Sbjct  177  YPKDDQTTTFTCPGG-TNYRVVFCP 200

Sequence Alignment: 7. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 236.9 bits 1037,  Expect = 4e-64
 Identities = 141/209 67%, Positives = 167/209 79%, Gaps = 11/209 5%
Query  9    VLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWG 68
            + FF     YT+AAT ++ N C YTVWAA++P GGGRRL++GQ+W IN   GT  ARIWG
Sbjct  16   ITFF----AYTHAATFDIVNQCTYTVWAAASP-GGGRRLDQGQSWNINVAPGTTQARIWG 70
Query  69   RTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIP 128
            RT CNF+A GRG C+TGDC G+L+C G+G+PPNTLAE+AL+Q +NLDF DIS VDGFNIP
Sbjct  71   RTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIP 130
Query  129  MTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGP--CGPT 186
            + F+PT      C  + C A I  +CP  L+ PGGCNNPCT F   +YCCT GP  CGPT
Sbjct  131  LEFSPTT---NVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPT 187
Query  187  ELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
             LS+FFK+RCPDAYSYPQDDPTS FTCP G TNYRVVFCP
Sbjct  188  PLSRFFKERCPDAYSYPQDDPTSLFTCPAG-TNYRVVFCP 226

Sequence Alignment: 8. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 182.5 bits 791,  Expect = 1e-47
 Identities = 111/193 57%, Positives = 135/193 69%, Gaps = 12/193 6%
Query  25   EVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQT 84
            +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G+CQT
Sbjct  30   DIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQT 88
Query  85   GDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAI 144
            GDCGG L CT  G  P TLAEY     S+ D++D+SLVDGFNIP+   PT     +C A 
Sbjct  89   GDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPT---NAQCTAP 142
Query  145  HCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCPDAYS 201
             C A+IN  CP  LKV GGCN+ C  F   QYCC       C  T  SK FK +CP AYS
Sbjct  143  ACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYS 202
Query  202  YPQDDPTSTFTCPGGSTNYRVVFCP 226
            Y +DD T+TF C  G T+Y +VFCP
Sbjct  203  YAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 9. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 180.3 bits 781,  Expect = 5e-47
 Identities = 110/197 55%, Positives = 136/197 69%, Gaps = 12/197 6%
Query  21   AATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRG 80
            A   +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G
Sbjct  26   AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
Query  81   TCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGK 140
            +C++GDCGG L CT  G  P TLAEY     S+ D++D+SLVDGFNIP+   PT     K
Sbjct  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQ---SDKDYYDVSLVDGFNIPLAINPTNT---K 138
Query  141  CHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
            C A  C A+IN  CP  LKV GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
Query  198  DAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
             AYSY +DD T+TF C  G T+Y +VFCP
Sbjct  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 180.3 bits 781,  Expect = 5e-47
 Identities = 110/197 55%, Positives = 136/197 69%, Gaps = 12/197 6%
Query  21   AATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRG 80
            A   +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G
Sbjct  26   AVKFDIKNQCRYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 84
Query  81   TCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGK 140
            +C++GDCGG L CT  G  P TLAEY     S+ D++D+SLVDGFNIP+   PT     K
Sbjct  85   SCRSGDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---K 138
Query  141  CHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCP 197
            C A  C A+IN  CP  LKV GGCN+ C  +   QYCC       C  T  SK FK +CP
Sbjct  139  CTAPACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCP 198
Query  198  DAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
             AYSY +DD T+TF C  G T+Y +VFCP
Sbjct  199  QAYSYAKDD-TATFACASG-TDYSIVFCP 225

Sequence Alignment: 11. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 177.2 bits 767,  Expect = 4e-46
 Identities = 107/193 55%, Positives = 134/193 69%, Gaps = 12/193 6%
Query  25   EVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQT 84
            +++N C YTVWAA  P GGG+ +++GQTW +N   GT  AR WGRTGC F+A+G+G+C++
Sbjct  4    DIKNQCGYTVWAAGLP-GGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 62
Query  85   GDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAI 144
            GDCGG L CT  G  P TLAEY     S+ D++D+SLVDGFNIP+   PT     KC A 
Sbjct  63   GDCGGQLSCTVSGAVPATLAEYTQ---SDQDYYDVSLVDGFNIPLAINPTNT---KCTAP 116
Query  145  HCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQG---PCGPTELSKFFKKRCPDAYS 201
             C A+IN  CP  LKV GGCN+ C  +   QYCC       C  T  SK FK +CP AYS
Sbjct  117  ACKADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAYS 176
Query  202  YPQDDPTSTFTCPGGSTNYRVVFCP 226
            Y +DD T+TF C  G T+Y +VFCP
Sbjct  177  YAKDD-TATFACASG-TDYSIVFCP 199

Sequence Alignment: 12. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 92.4 bits 383,  Expect = 6e-21
 Identities = 53/89 59%, Positives = 64/89 71%, Gaps = 2/89 2%
Query  21   AATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRG 80
            A   +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G
Sbjct  6    AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 64
Query  81   TCQTGDCGGVLQCTGWGKPPNTLAEYAL-DQ 110
            +CQTGDCG  L CT  G  P TLAEY   DQ
Sbjct  65   SCQTGDCGRQLSCTVSGAVPATLAEYTQSDQ 95

Sequence Alignment: 13. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 92.4 bits 383,  Expect = 6e-21
 Identities = 53/89 59%, Positives = 64/89 71%, Gaps = 2/89 2%
Query  21   AATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRG 80
            A   +++N C YTVWAA  P GGG+RL++GQTW +N   GT  AR WGRTGC F+A+G+G
Sbjct  6    AVKFDIKNQCGYTVWAAGLP-GGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKG 64
Query  81   TCQTGDCGGVLQCTGWGKPPNTLAEYAL-DQ 110
            +CQTGDCG  L CT  G  P TLAEY   DQ
Sbjct  65   SCQTGDCGRQLSCTVSGAVPATLAEYTQSDQ 95

Sequence Alignment: 14. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 63.7 bits 254,  Expect = 6e-12
 Identities = 100/211 47%, Positives = 129/211 61%, Gaps = 27/211 12%
Query  9    VLFFLLCVTYTYAATIEVRNNCPYTVWAAST-----PIGG--GRRLNRGQTWVINAPRGT 61
            +LFF    +  +AA I   NNCP TVW  +      P     G  L    +  ++AP   
Sbjct  16   ILFF----SGAHAAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAPSPW 71
Query  62   KMARIWGRTGCNFNAAGRGTCQTGDCG-GVLQCTGWGK-PPNTLAEYALDQFSNLDFWDI 119
               R WGRT C+ +AAG+ TC+T DCG G + C G G  PP TL E  +      D++D+
Sbjct  72   S-GRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDV 130
Query  120  SLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPCTTFGG 173
            SLVDGFN+PM+ AP +   G+C    C AN+N  CP  L+V         C + C  FG 
Sbjct  131  SLVDGFNLPMSVAP-QGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGD 189
Query  174  QQYCCT---QGP--CGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
             +YCCT     P  C PTE S+ F+K+CP AYSY  DD  STFTC GG  +Y + FCP
Sbjct  190  SKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGP-DYVITFCP 246

Sequence Alignment: 15. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 61.5 bits 244,  Expect = 3e-11
 Identities = 94/204 46%, Positives = 118/204 57%, Gaps = 23/204 11%
Query  20   YAATIEVRNNCPYTVWAASTPIGG-------GRRLNRGQTWVINAPRGTKMARIWGRTGC 72
            +AATI  +NNCPY VW  +            G  L    ++ ++ P      R W RTGC
Sbjct  22   HAATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQLDTPVPWN-GRFWARTGC 80
Query  73   NFNAAGRGTCQTGDCG-GVLQCTGWGK-PPNTLAEYALDQFSNLDFWDISLVDGFNIPMT 130
            + +A+G+  C T DC  G + C G G  PP TLAE+ +      DF+D+SLVDGFN+PM+
Sbjct  81   STDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAGGGQDFYDVSLVDGFNLPMS 140
Query  131  FAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPCTTFGGQQYCCT---QG 181
              P +   G C    C AN+N  CP  L+  G       C + C  FG  QYCCT     
Sbjct  141  VTP-QGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACLSACVKFGTPQYCCTPPQNT 199
Query  182  P--CGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
            P  C PT  S+ F   CPDAYSY  DD   TFTC GG  NY + FCP
Sbjct  200  PETCPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGP-NYAITFCP 245

Sequence Alignment: 16. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 60.2 bits 238,  Expect = 7e-11
 Identities = 97/211 45%, Positives = 124/211 58%, Gaps = 20/211 9%
Query  13   LLCVTYTYAATIEVRNNCPYTVWAAS--TPIGG--GRRLNRGQTWVINAPRGTKMARIWG 68
            LL     +AAT+  +NNCPYTVW AS   P     G  L    ++ ++ P      R W 
Sbjct  15   LLSFGGAHAATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWS-GRFWA 73
Query  69   RTGCNFNAAGRGTCQTGDC-GGVLQCTGW-GKPPNTLAEYALDQFSNLDFWDISLVDGFN 126
            RT C+ +A+G+  C+T DC  G L C G  G PP TLAE+ +      DF+D+SLVDGFN
Sbjct  74   RTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFN 133
Query  127  IPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPCTTFGGQQYCCT- 179
            +PM+  P +   G C    C AN+N  CP  L+  G       C + C  FG  QYCCT 
Sbjct  134  LPMSVTP-QGGTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTP 192
Query  180  ----QGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
                +  C PT  S+ F ++CPDAYSY  DD    FTC GG  NY + FCP
Sbjct  193  PQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGP-NYLITFCP 242

Sequence Alignment: 17. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 60.2 bits 238,  Expect = 7e-11
 Identities = 102/216 47%, Positives = 133/216 61%, Gaps = 27/216 12%
Query  4    LTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAAST-----PIGG--GRRLNRGQTWVIN 56
            LT+  +LFF    +  +AA I   N C YTVW  +      P     G +L  G +  ++
Sbjct  11   LTTLAILFF----SGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATGISRSVD 66
Query  57   APRGTKMARIWGRTGCNFNAAGRGTCQTGDCG-GVLQCTGWGK-PPNTLAEYALDQFSNL 114
            AP      R +GRT C+ +A+G+ TC T DCG G + C G G  PP TL E  +      
Sbjct  67   AP-SPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQ 125
Query  115  DFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPC 168
            DF+D+SLVDGFN+PM+ AP +   GKC A  C A+IN  CP  L+V G       C + C
Sbjct  126  DFYDVSLVDGFNLPMSVAP-QGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIACKSAC 184
Query  169  TTFGGQQYCCT---QGP--CGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVV 223
              F   +YCCT     P  C PT+ SK+FK +CP AYSY  DD +STFTC  G  +Y + 
Sbjct  185  LAFNQPKYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTC-SGRPDYLIT 243
Query  224  FCP 226
            FCP
Sbjct  244  FCP 246

Sequence Alignment: 18. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 59.8 bits 236,  Expect = 1e-10
 Identities = 101/216 46%, Positives = 133/216 61%, Gaps = 27/216 12%
Query  4    LTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAAST-----PIGG--GRRLNRGQTWVIN 56
            LT+  +LFF    +  +AA I   N C YTVW  +      P     G  L  G +  ++
Sbjct  11   LTTLAILFF----SGAHAAKITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATGISNSVD 66
Query  57   APRGTKMARIWGRTGCNFNAAGRGTCQTGDCG-GVLQCTGWGK-PPNTLAEYALDQFSNL 114
            AP      R +GRT C+ +A+G+ TC T DCG G + C G G  PP TL E  + +    
Sbjct  67   AP-SPWSGRFFGRTRCSTDASGKFTCATADCGSGQVSCNGNGAVPPATLVEITIAENGGQ 125
Query  115  DFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGG------CNNPC 168
            DF+D+SLVDGFN+PM+ AP +   G+C A  C A+IN  CP  L+V G       C + C
Sbjct  126  DFYDVSLVDGFNLPMSVAP-QGGTGECKASTCPADINKVCPAELQVKGSDGSVIACKSAC 184
Query  169  TTFGGQQYCCT---QGP--CGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVV 223
              +   QYCCT     P  C PT+ SK+FK +CP AYSY  DD +STFTC  G  +Y + 
Sbjct  185  LALNQPQYCCTPPNDKPETCPPTDYSKLFKTQCPQAYSYAYDDKSSTFTC-SGRPDYLIT 243
Query  224  FCP 226
            FCP
Sbjct  244  FCP 246

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.