The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MIKSFLLFSIYIGSIWTLPVSELAGMHQMDEGMINVGDNKPTNLTICKDKKDGALIGDEH
DRTLFYECSNGLAFPFHCPPGLIFDDTRGTCTFDPDASTKKPPYHGNSKFNCTGKEDDFY
PDEKDATKFHECVNGYPYDFECPPNTVFDAKRKACAFRSAEQSLEENEQSQPQPQSQKQH
RQARDVTESTTTVVTEQSTDQSVRRHRRNDEQQQKHHHQLEEIAKEKNIDLHIIETTTPE
NFDVWID
Sequence Info Allergen Name Length Opt Bits Score E Value
AVD73319 Der p 37.0101 247 1730 368.9 8.9e-104
QBF67839 Der f 37.0101 250 1374 294.6 2e-81
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 37.0101 Sequence ID: AVD73319

 Score = 368.9 bits 1730,  Expect = 9e-104
 Identities = 247/247 100%, Positives = 247/247 100%, Gaps = 0/247 0%
Query  1    MIKSFLLFSIYIGSIWTLPVSELAGMHQMDEGMINVGDNKPTNLTICKDKKDGALIGDEH 60
            MIKSFLLFSIYIGSIWTLPVSELAGMHQMDEGMINVGDNKPTNLTICKDKKDGALIGDEH
Sbjct  1    MIKSFLLFSIYIGSIWTLPVSELAGMHQMDEGMINVGDNKPTNLTICKDKKDGALIGDEH 60
Query  61   DRTLFYECSNGLAFPFHCPPGLIFDDTRGTCTFDPDASTKKPPYHGNSKFNCTGKEDDFY 120
            DRTLFYECSNGLAFPFHCPPGLIFDDTRGTCTFDPDASTKKPPYHGNSKFNCTGKEDDFY
Sbjct  61   DRTLFYECSNGLAFPFHCPPGLIFDDTRGTCTFDPDASTKKPPYHGNSKFNCTGKEDDFY 120
Query  121  PDEKDATKFHECVNGYPYDFECPPNTVFDAKRKACAFRSAEQSLEENEQSQPQPQSQKQH 180
            PDEKDATKFHECVNGYPYDFECPPNTVFDAKRKACAFRSAEQSLEENEQSQPQPQSQKQH
Sbjct  121  PDEKDATKFHECVNGYPYDFECPPNTVFDAKRKACAFRSAEQSLEENEQSQPQPQSQKQH 180
Query  181  RQARDVTESTTTVVTEQSTDQSVRRHRRNDEQQQKHHHQLEEIAKEKNIDLHIIETTTPE 240
            RQARDVTESTTTVVTEQSTDQSVRRHRRNDEQQQKHHHQLEEIAKEKNIDLHIIETTTPE
Sbjct  181  RQARDVTESTTTVVTEQSTDQSVRRHRRNDEQQQKHHHQLEEIAKEKNIDLHIIETTTPE 240
Query  241  NFDVWID 247
            NFDVWID
Sbjct  241  NFDVWID 247

Sequence Alignment: 2. Allergen Name: Der f 37.0101 Sequence ID: QBF67839

 Score = 294.6 bits 1374,  Expect = 2e-81
 Identities = 194/246 78%, Positives = 215/246 87%, Gaps = 5/246 2%
Query  1    MIKSFLLF-SIYIGSIWTLPVSELAGMHQMDEGMINVGDNKPTNLTICKDKKDGALIGDE 59
            MIK ++LF S YI S+W LPVSELAGMHQ+DEGMINV DNKPTNLTIC DKKDG L+GDE
Sbjct  1    MIKFYFLFCSFYIVSVWMLPVSELAGMHQLDEGMINVDDNKPTNLTICVDKKDGTLLGDE 60
Query  60   HDRTLFYECSNGLAFPFHCPPGLIFDDTRGTCTFDPDASTKKPPYHGNSKFNCTGKEDDF 119
            HDRTLFYECSNGLAFPFHCP  LIFD+TRG C FDP++ TK+PP HGNS +NCTGKED F
Sbjct  61   HDRTLFYECSNGLAFPFHCPSNLIFDETRGVCIFDPNSPTKRPPNHGNSTYNCTGKEDGF 120
Query  120  YPDEKDATKFHECVNGYPYDFECPPNTVFDAKRKACAFRSAEQSLEENEQSQPQPQSQKQ 179
            YPDE DATKFHECVNGYPYDF+CPPNT++D KRK CA++S E+  EENEQ QPQPQ Q+Q
Sbjct  121  YPDENDATKFHECVNGYPYDFKCPPNTIYDVKRKVCAYKSIERPKEENEQPQPQPQ-QQQ 179
Query  180  HRQARDVTESTTTVVTEQ-STDQSVRRHRRNDEQQQK--HHHQLEEIAKEKNIDLHIIET 236
            HR  RDV ESTT  + E+  T+QSVRRHRRNDEQQQ+  HHHQLEE AKEKNIDLHIIET
Sbjct  180  HRAVRDVIESTTAEIKEELPTEQSVRRHRRNDEQQQQQHHHHQLEEFAKEKNIDLHIIET 239
Query  237  TTPENFDVWID 247
            TT ENFDVWID
Sbjct  240  TTQENFDVWID 250

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.