The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA
NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN
VVVTVKLIGDNGVLACAIATHGKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
Q00855 Der f 2 146 978 231.0 1e-62
BAA01239 Der f 2 138 921 218.0 8e-59
BAA01241 Der f 2 138 912 215.9 3.4e-58
CAK22338 Der p 2.0114 146 886 209.9 2.2e-56
P49278 Der p 2 146 881 208.8 5e-56
Q9TZZ2 Eur m 2 145 840 199.4 3.3e-53
ABA39438 Der f 2.0109 129 837 198.7 4.7e-53
AAK30133 Der f 2 170 822 195.2 7e-52
CAQ68249 Der p 2.0115 129 809 192.3 4e-51
ABA39437 Der p 2.0109 129 809 192.3 4e-51
AAC82350 Eur m 2.0102 135 792 188.4 6.3e-50
A6XEN8 Blo t 2.0104 142 424 104.0 1.7e-24
A6XEN9 Blo t 2.0104 142 424 104.0 1.7e-24
A6XEP1 Blo t 2.0104 142 417 102.4 5.1e-24
A6XEP2 Blo t 2.0104 142 417 102.4 5.1e-24
A6XEP6 Blo t 2.0104 142 417 102.4 5.1e-24
A6XEP3 Blo t 2.0104 142 416 102.1 6e-24
O02380 Tyr p 2 141 413 101.5 9.6e-24
P80384 Lep d 2 141 413 101.5 9.6e-24
A6XEP5 Blo t 2.0104 142 413 101.5 9.7e-24
BAX34757 Der f 35.0101 143 411 101.0 1.3e-23
A6XEP4 Blo t 2.0104 142 410 100.8 1.6e-23
CAD32313 Lep d 2.0102 141 408 100.3 2.1e-23
CAD32314 Lep d 2.0202 141 408 100.3 2.1e-23
A6XEP0 Blo t 2.0104 142 407 100.1 2.5e-23
CAA58755 Lep d 2.0201 141 403 99.2 4.7e-23
AAQ73482 Blo t 2.0102 142 403 99.2 4.8e-23
CAB76459 Gly d 2.0201 125 397 97.8 1.1e-22
AAQ73483 Blo t 2.0101 144 396 97.6 1.5e-22
CAB59976 Gly d 2.0101 128 372 92.1 5.8e-21
AAQ73481 Blo t 2.0103 141 367 90.9 1.4e-20
CAA57160 Lep d 2.0101 98 310 77.9 8.1e-17
ABG76195 Der f 22.0101 155 284 71.9 8.7e-15
Q28895 Can f 7.0101 149 173 46.4 3.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 231.0 bits 978,  Expect = 1e-62
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA 60
            MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA
Sbjct  1    MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA 60
Query  61   NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKLIGDNGVLACAIATHGKIRD 146
            VVVTVKLIGDNGVLACAIATHGKIRD
Sbjct  121  VVVTVKLIGDNGVLACAIATHGKIRD 146

Sequence Alignment: 2. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 218.0 bits 921,  Expect = 8e-59
 Identities = 137/138 99%, Positives = 138/138 100%, Gaps = 0/138 0%
Query  9    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 68
            SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  69   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 128
            IEIKASLDGLEIDVPGIDTNACHF+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  129  GDNGVLACAIATHGKIRD 146
            GDNGVLACAIATHGKIRD
Sbjct  121  GDNGVLACAIATHGKIRD 138

Sequence Alignment: 3. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 215.9 bits 912,  Expect = 3e-58
 Identities = 135/138 97%, Positives = 136/138 98%, Gaps = 0/138 0%
Query  9    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 68
            SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  69   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 128
            IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYD KYTWNVPKIAPKSENVVVTVKL+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  129  GDNGVLACAIATHGKIRD 146
            GDNGVLACAIATH KIRD
Sbjct  121  GDNGVLACAIATHAKIRD 138

Sequence Alignment: 4. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 209.9 bits 886,  Expect = 2e-56
 Identities = 128/146 87%, Positives = 139/146 95%, Gaps = 0/146 0%
Query  1    MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA 60
            M+ KILCLSLLVAAV ADQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEALF+A
Sbjct  1    MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEA 60
Query  61   NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTK AKIEIKAS+DGLE+DVPGID NACH++KCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKLIGDNGVLACAIATHGKIRD 146
            VVVTVK++GDNGVLACAIATH KIRD
Sbjct  121  VVVTVKVLGDNGVLACAIATHAKIRD 146

Sequence Alignment: 5. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 208.8 bits 881,  Expect = 5e-56
 Identities = 127/146 86%, Positives = 139/146 95%, Gaps = 0/146 0%
Query  1    MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDA 60
            M+ KILCLSLLVAAV  DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+A
Sbjct  1    MMYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEA 60
Query  61   NQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
            NQNTKTAKIEIKAS+DGLE+DVPGID NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSEN
Sbjct  61   NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSEN 120
Query  121  VVVTVKLIGDNGVLACAIATHGKIRD 146
            VVVTVK++GD+GVLACAIATH KIRD
Sbjct  121  VVVTVKVMGDDGVLACAIATHAKIRD 146

Sequence Alignment: 6. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 199.4 bits 840,  Expect = 3e-53
 Identities = 120/143 83%, Positives = 132/143 92%, Gaps = 0/143 0%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            KILCLSLLVAAV ADQVD+KDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN
Sbjct  3    KILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQN 62
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            +  AKIEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+YDIKYTWNVP+IAPKSENVVV
Sbjct  63   SNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVV 122
Query  124  TVKLIGDNGVLACAIATHGKIRD 146
            TVKL+GDNGVLACAIATH KIRD
Sbjct  123  TVKLLGDNGVLACAIATHAKIRD 145

Sequence Alignment: 7. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 198.7 bits 837,  Expect = 5e-53
 Identities = 122/129 94%, Positives = 127/129 98%, Gaps = 0/129 0%
Query  18   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 77
            DQVDVKDCANNEIKKVMVDG HGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKA+++G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 137
            LE+DVPGIDTNACHF+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  138  IATHGKIRD 146
            IATH KIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 8. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 195.2 bits 822,  Expect = 7e-52
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 29/141 20%
Query  6    LCLSLLVAAVVADQVDVKDC-----------------------------ANNEIKKVMVD 36
            LCLSLLVAAVVADQVDVKDC                             ANNEIKKVMVD
Sbjct  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
Query  37   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 96
            GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP
Sbjct  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
Query  97   LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 146
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sbjct  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 9. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 192.3 bits 809,  Expect = 4e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  18   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 77
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 137
            LE+DVPGID NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  138  IATHGKIRD 146
            IATH KIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 10. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 192.3 bits 809,  Expect = 4e-51
 Identities = 114/129 88%, Positives = 125/129 96%, Gaps = 0/129 0%
Query  18   DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 77
            DQVDVKDCAN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 137
            LE+DVPGID NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  138  IATHGKIRD 146
            IATH KIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 11. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 188.4 bits 792,  Expect = 6e-50
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 0/135 0%
Query  12   VAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEI 71
            VAAV ADQVDVKDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AKIEI
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  72   KASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDN 131
            KA++DG+EIDVPGID N CHFMKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDN
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  132  GVLACAIATHGKIRD 146
            GVLACAIATH KIRD
Sbjct  121  GVLACAIATHAKIRD 135

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 104.0 bits 424,  Expect = 2e-24
 Identities = 58/131 44%, Positives = 89/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D C IH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 104.0 bits 424,  Expect = 2e-24
 Identities = 57/131 43%, Positives = 89/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D C IH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V  
Sbjct  62   SEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 102.4 bits 417,  Expect = 5e-24
 Identities = 58/131 44%, Positives = 88/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 102.4 bits 417,  Expect = 5e-24
 Identities = 58/131 44%, Positives = 88/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 102.4 bits 417,  Expect = 5e-24
 Identities = 58/131 44%, Positives = 88/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 102.1 bits 416,  Expect = 6e-24
 Identities = 57/131 43%, Positives = 88/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + +  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTIT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 18. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 101.5 bits 413,  Expect = 1e-23
 Identities = 65/136 47%, Positives = 88/136 64%, Gaps = 7/136 5%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K L L  LVA   A QV   DC   EI  V VDGC G D C+IH+ KP  + A F ANQ+
Sbjct  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T   ++++   L+GLE+ +PGI+T+ C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
Query  124  TVKLI--GDNGVLAC-AIATHGK 143
             VKL+  G++GVLAC A+ T  K
Sbjct  118  VVKLLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 19. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 101.5 bits 413,  Expect = 1e-23
 Identities = 61/138 44%, Positives = 89/138 64%, Gaps = 3/138 2%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+
Sbjct  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T    I++ A + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   V
Sbjct  62   TAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADV 120
Query  124  TVKLIGDNGVLACAIATHGKI 144
            T +LIGD+GV+AC    HG++
Sbjct  121  TAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 101.5 bits 413,  Expect = 1e-23
 Identities = 56/131 42%, Positives = 88/131 67%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + +  C G D C IH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSG-DHCTIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V  
Sbjct  62   SEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 21. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 101.0 bits 411,  Expect = 1e-23
 Identities = 59/140 42%, Positives = 94/140 67%, Gaps = 4/140 2%
Query  4    KILCLSLLVAAVV-ADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQ 62
            K LC+  L  AV  A ++   DC + E+  + V GC G D C++H+GK   L+    +NQ
Sbjct  3    KFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKSNQ 61
Query  63   NTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVV 122
            +++  K+ I A ++G+EI+VPG D + CH+++CP+ KGQ YDIKY++NVP + P  +  +
Sbjct  62   DSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTL 121
Query  123  VTVKLIGDNGVLACAIATHGKIRD 146
             T K+IGDNG++ C +  +G+I D
Sbjct  122  -TAKVIGDNGLVGC-LKLNGEIAD 143

Sequence Alignment: 22. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 100.8 bits 410,  Expect = 2e-23
 Identities = 57/131 43%, Positives = 87/131 66%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC   D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 100.3 bits 408,  Expect = 2e-23
 Identities = 60/138 43%, Positives = 88/138 63%, Gaps = 3/138 2%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+
Sbjct  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T    I++   + G  I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   V
Sbjct  62   TAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADV 120
Query  124  TVKLIGDNGVLACAIATHGKI 144
            T +LIGD+GV+AC    HG++
Sbjct  121  TAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 24. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 100.3 bits 408,  Expect = 2e-23
 Identities = 59/138 42%, Positives = 88/138 63%, Gaps = 3/138 2%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+
Sbjct  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T    I++ A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V V
Sbjct  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDV 120
Query  124  TVKLIGDNGVLACAIATHGKI 144
            T +L+GD+GV+AC    HG++
Sbjct  121  TAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 25. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 100.1 bits 407,  Expect = 3e-23
 Identities = 57/131 43%, Positives = 87/131 66%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+   A  V   DCA+ E+  + + GC G D CII +GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 26. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 99.2 bits 403,  Expect = 5e-23
 Identities = 58/138 42%, Positives = 87/138 63%, Gaps = 3/138 2%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K + L  LVA   A ++  KDC + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+
Sbjct  3    KFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            T    I++ A + G  I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK +   V
Sbjct  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-ADV 120
Query  124  TVKLIGDNGVLACAIATHGKI 144
            T +L+GD+GV+AC    HG++
Sbjct  121  TAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 27. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 99.2 bits 403,  Expect = 5e-23
 Identities = 56/131 42%, Positives = 86/131 65%, Gaps = 2/131 1%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV+      V    CA+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 61
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  62   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 120
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  121  TASLVGDHGVVAC 133

Sequence Alignment: 28. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 97.8 bits 397,  Expect = 1e-22
 Identities = 58/116 50%, Positives = 79/116 68%, Gaps = 2/116 1%
Query  19   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGL 78
            ++  KDC   E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  79   EIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 136
             I VPG++T+ C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 29. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 97.6 bits 396,  Expect = 1e-22
 Identities = 59/131 45%, Positives = 88/131 67%, Gaps = 4/131 3%
Query  4    KILCLSLLVAAVVADQVDVK--DCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDAN 61
            K +CL+LL     A   DVK  DCA+ E+  + + GC G D CIIH+GK FTL+ +F AN
Sbjct  3    KFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIAN 61
Query  62   QNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
            Q+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  62   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 121
Query  122  VVTVKLIGDNGVLAC 136
              T  L+GD+GV+AC
Sbjct  122  T-TASLVGDHGVVAC 135

Sequence Alignment: 30. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 92.1 bits 372,  Expect = 6e-21
 Identities = 54/116 46%, Positives = 85/116 73%, Gaps = 4/116 3%
Query  19   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG- 77
            +++  DC +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  78   LEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 136
            + ID+PG++TNAC +MKCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 31. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 90.9 bits 367,  Expect = 1e-20
 Identities = 54/130 41%, Positives = 85/130 65%, Gaps = 3/130 2%
Query  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
            K +CL+LLV++        + C   E+  + + GC G D CIIH+GK FTL+ +F ANQ+
Sbjct  3    KFICLALLVSSRRQRCQIYRSCTW-EVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQD 60
Query  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
            ++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V  
Sbjct  61   SEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT- 119
Query  124  TVKLIGDNGVLAC 136
            T  L+GD+GV+AC
Sbjct  120  TASLVGDHGVVAC 132

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 77.9 bits 310,  Expect = 8e-17
 Identities = 46/97 47%, Positives = 65/97 67%, Gaps = 2/97 2%
Query  46   IHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDI 105
            IHRG+  TLEA F ANQ+T    I++ A + G  I VPG++T+ C F+KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  106  KYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKI 144
             Y+  +P I PK +   VT +LIGD+GV+AC    HG++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 71.9 bits 284,  Expect = 9e-15
 Identities = 59/130 45%, Positives = 81/130 62%, Gaps = 13/130 10%
Query  5    ILCLSL--LVAAVVADQVDV--KDCANNEIKKVMVDGCHGSDP-CIIHRGKPFTLEALFD 59
            I+C++L  L AAV AD+ +V  KDC +NEIK   V G + +   C+IH+     L   F 
Sbjct  6    IVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFV 65
Query  60   ANQNTKTAKIEIK--ASLDGLEIDVPGID-TNAC--HFMKCPLVKGQQYDIKYTWNVPKI 114
            AN+NT   KI  +   +L G+E+  PGID T+AC  H + CPL KGQ Y+    +N+   
Sbjct  66   ANENTGN-KINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDD 124
Query  115  APKSENVVVTVKL-IGDNGVLAC 136
             P + NV  TV+L  G  G L C
Sbjct  125  VP-TANVTATVRLENGHGGDLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 46.4 bits 173,  Expect = 4e-07
 Identities = 33/109 30%, Positives = 60/109 55%, Gaps = 7/109 6%
Query  20   VDVKDC--ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG 77
            V  KDC  A   IK++ V+ C  + PC +H+G+ +++   F +N  ++++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  78   LEIDVPGIDTNACHF-MKCPLVKGQQYDIKYTWNVP-KIAPKSENVVVTVKLIGDN 131
            + +  P  + + C   + CP+ K + Y   Y   +P K    S  +VV   L+GDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYS--YLNKLPVKNEYPSIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.