The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC
INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN
YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP
Sequence Info Allergen Name Length Opt Bits Score E Value
Q28133 Bos d 2.0101 172 1136 266.0 4.1e-73
B59225 Bos d 2.0103 156 1031 242.1 5.7e-66
A59225 Bos d 2.0102 156 1025 240.7 1.5e-65
CAX62130 Cav p 3.0101 170 399 98.0 1.5e-22
Q9QXU1 Mes a 1.0101 172 393 96.6 3.9e-22
S5ZYD3 Phod s 1.0101 151 320 80.1 3.3e-17
Q95182 Equ c 1 187 296 74.5 2e-15
AAS77253 Fel d 4 186 281 71.1 2.1e-14
U6C8D6 Ory c 4.0101 172 254 64.9 1.4e-12
P02761 Rat n 1 181 247 63.3 4.4e-12
S0BDX9 Cav p 6.0101 181 236 60.8 2.5e-11
XP_855342 Can f 6.0101 190 231 59.6 5.9e-11
P02762 Mus m 1 180 207 54.2 2.4e-09
AAA39768 Mus m 1.0102 180 201 52.8 6.3e-09
O18873 Can f 1 174 124 35.3 0.0012
P81216 Equ c 2 29 83 29.9 0.0079
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 2.0101 Sequence ID: Q28133

 Score = 266.0 bits 1136,  Expect = 4e-73
 Identities = 172/172 100%, Positives = 172/172 100%, Gaps = 0/172 0%
Query  1    MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC 60
            MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC
Sbjct  1    MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC 60
Query  61   INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN 120
            INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN
Sbjct  61   INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN 120
Query  121  YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 172
            YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP
Sbjct  121  YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 172

Sequence Alignment: 2. Allergen Name: Bos d 2.0103 Sequence ID: B59225

 Score = 242.1 bits 1031,  Expect = 6e-66
 Identities = 155/156 99%, Positives = 155/156 99%, Gaps = 0/156 0%
Query  17   QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 76
            QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ
Sbjct  1    QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 60
Query  77   GTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVENYDGERITKMTEGLAKG 136
            GTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTY ENYDGERITKMTEGLAKG
Sbjct  61   GTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYAENYDGERITKMTEGLAKG 120
Query  137  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 172
            TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP
Sbjct  121  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 156

Sequence Alignment: 3. Allergen Name: Bos d 2.0102 Sequence ID: A59225

 Score = 240.7 bits 1025,  Expect = 1e-65
 Identities = 155/156 99%, Positives = 155/156 99%, Gaps = 0/156 0%
Query  17   QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 76
            QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ
Sbjct  1    QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 60
Query  77   GTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVENYDGERITKMTEGLAKG 136
            GTCLLLTEVAKRQEGYVYVLEF GTNTLEVIHVSENMLVTYVENYDGERITKMTEGLAKG
Sbjct  61   GTCLLLTEVAKRQEGYVYVLEFDGTNTLEVIHVSENMLVTYVENYDGERITKMTEGLAKG 120
Query  137  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 172
            TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP
Sbjct  121  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 156

Sequence Alignment: 4. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 98.0 bits 399,  Expect = 2e-22
 Identities = 66/166 39%, Positives = 103/166 62%, Gaps = 6/166 3%
Query  1    MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC 60
            M+ ++L L  GL    Q     +DPS+I G+W  I  AADN +KI EGGPLR Y+  + C
Sbjct  1    MQILLLALTIGLAYAHQ----TLDPSEINGQWHTISIAADNVEKIGEGGPLRGYFHNLHC 56
Query  61   INDCESLSITFYLKDQGTCLLLTEV-AKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVE 119
             + C+++ +TFY+K  G C  +  + AK+++  VYV ++ GTN +EVI   E+ +  Y  
Sbjct  57   YDGCKNIGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHFEVIGKKEDAIAFYNH 116
Query  120  NYDGE-RITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            N D   + TKM   +A+  S+T EE +K Q++  E+G+P +NI  + + D C
Sbjct  117  NTDETGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTC 168

Sequence Alignment: 5. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 96.6 bits 393,  Expect = 4e-22
 Identities = 56/169 33%, Positives = 101/169 59%, Gaps = 1/169 0%
Query  1    MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC 60
            +K ++L L +G+ C AQ    E+ PS++ G+W  +Y AADNK K+ EGGPLR Y + +EC
Sbjct  2    VKFLLLALALGVSC-AQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC 60
Query  61   INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN 120
             ++C++++I FY K +  C     V ++ +   Y+ +F G N + V+  +++ +  +  N
Sbjct  61   SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN 120
Query  121  YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
             D    T +   + KG S + E+ +++++   +  +P ENIE+L+ TD C
Sbjct  121  VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170

Sequence Alignment: 6. Allergen Name: Phod s 1.0101 Sequence ID: S5ZYD3

 Score = 80.1 bits 320,  Expect = 3e-17
 Identities = 51/147 34%, Positives = 79/147 53%, Gaps = 3/147 2%
Query  24   DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCLLLT 83
            D +++ G+W  I  AADN  KI E GPLR Y R + C  DC  + +TFY+     C   T
Sbjct  2    DYAELEGKWDTIAIAADNDAKIKEEGPLRLYVRELYCNEDCSEMEVTFYVNANNQCSKTT 61
Query  84   EVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVENYD--GERITKMTEGLAKGTSFTP 141
             +  +Q    Y  +F G N ++ ++ +   +V   +N D  G+  T +   + K   +TP
Sbjct  62   VIGYKQADGTYRTQFEGDNRFQPVYATPENIVFTSKNVDRAGQE-TNLIFVVGKSQPLTP 120
Query  142  EELEKYQQLNSERGVPNENIENLIKTDNCP 171
            E+ EK  ++  E  +P ENI N++ TD CP
Sbjct  121  EQHEKLVEFAHENNIPEENIHNVLATDTCP 150

Sequence Alignment: 7. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 74.5 bits 296,  Expect = 2e-15
 Identities = 58/169 34%, Positives = 94/169 55%, Gaps = 8/169 4%
Query  1    MKAVFLTLLFGLVCTAQETPAEI-----DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYY 55
            MK ++L L + LVC  QE  +++     D SKI GEW  I+ A+D K+KI E G +R + 
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFV 60
Query  56   RRIECINDCESLSITFYLKDQGTCLLLTEV-AKRQEGYVYVLEFYGTNTLEVIHV-SENM 113
              I  + D  SL   +  K  G C  +  V  K +E  VY L + G N + +    ++  
Sbjct  61   DVIRAL-DNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEH 119
Query  114  LVTYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            ++ Y+ N+D +R  ++ E  A+    +PE  E++ ++  +RG+  ENI +L K D C
Sbjct  120  IILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRC 176

Sequence Alignment: 8. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 71.1 bits 281,  Expect = 2e-14
 Identities = 55/167 32%, Positives = 92/167 55%, Gaps = 7/167 4%
Query  1    MKAVFLTLLFGLVCTAQETP---AEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRR 57
            MK ++L L + LVC  +E     + ID SKI GEW  I  A+D K+KI E G +R +   
Sbjct  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
Query  58   IECINDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVT 116
            I+ + D  SLS  F+ K+ G C  +  VA + +  VY + + G N + ++  V +  ++ 
Sbjct  61   IKAL-DNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
Query  117  YVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            ++ N+D  R  ++ E  A+    + +  EK+ +   E G+   NI +L + D C
Sbjct  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRC 171

Sequence Alignment: 9. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 64.9 bits 254,  Expect = 1e-12
 Identities = 46/158 29%, Positives = 83/158 52%, Gaps = 5/158 3%
Query  12   LVCTAQETPAEI--DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSI 69
            L+C  +   A    + S+I GEW  +  A+D+++KI E G +R +   I    +  SLS 
Sbjct  2    LICAPKRGDAHSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNS-SLSF 60
Query  70   TFYLKDQGTCL-LLTEVAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVTYVENYDGERIT 127
             F+    G C  L+      ++ +VY +E+ G N + ++  V ++ ++ ++ N++     
Sbjct  61   KFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESF 120
Query  128  KMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            ++ E   +G     +  EK+ QL  ERG+  ENI +L K D C
Sbjct  121  QLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRC 163

Sequence Alignment: 10. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 63.3 bits 247,  Expect = 4e-12
 Identities = 54/167 32%, Positives = 92/167 55%, Gaps = 12/167 7%
Query  1    MKAVFLTLLFGL--VC----TAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNY 54
            MK ++L L +GL  VC     A  T   +D +K+ G+W  I  A++ ++KI E G +R +
Sbjct  1    MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVF 60
Query  55   YRRIECINDCESLSITFYLKDQGTCLLLTEVA-KRQEGYVYVLEFYGTNTLEVIHVSENM 113
             + I+ + +  SL   F +K+ G C  L  VA K  E   Y +E+ G NT+ ++    + 
Sbjct  61   MQHIDVLEN--SLGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDR 118
Query  114  LVTY-VENY-DGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
             V + + N+ +GE    M     +   ++ +  EK+ +L    G+  +NI +L KTD C
Sbjct  119  YVMFHLINFKNGETFQLMVL-YGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRC 176

Sequence Alignment: 11. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 60.8 bits 236,  Expect = 3e-11
 Identities = 45/169 26%, Positives = 81/169 47%, Gaps = 6/169 3%
Query  1    MKAVFLTLLFGLVCTAQETPAEI----DPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYR 56
            MK  +L L + L+CT  E    +    D  KI G W  +  A+D ++ I EGG +R +  
Sbjct  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
Query  57   RIECINDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVS-ENMLV 115
             IE + D  +LS  F+  + G C  ++ +  R    VY +E+ G N + V     +N  +
Sbjct  61   SIEPVKDS-ALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAI 119
Query  116  TYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
              + N+  E   ++ E   +    + E   +++ +  + G+   NI ++   D C
Sbjct  120  FQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRC 174

Sequence Alignment: 12. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 59.6 bits 231,  Expect = 6e-11
 Identities = 49/169 28%, Positives = 88/169 52%, Gaps = 7/169 4%
Query  1    MKAVFLTLLFGLVCTAQE----TPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYR 56
            MK ++L L + LV   +E         D SKI G+W  I  A+D K+KI E G +R + +
Sbjct  1    MKLLLLCLGLILVHAHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK 60
Query  57   RIECINDCESLSITFYLKDQGTCLLLTEVAKRQE-GYVYVLEFYGTNTLEVIHVS-ENML 114
             IE +++  SL  T + K  G C  ++ +  + E    Y +   G N + +I  + E+ +
Sbjct  61   DIEVLSNS-SLIFTMHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYI 119
Query  115  VTYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            + ++ N + E+  ++ E   +    +P+  EK+ +      +P ENI +L + D C
Sbjct  120  IFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRC 175

Sequence Alignment: 13. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 54.2 bits 207,  Expect = 2e-09
 Identities = 53/166 31%, Positives = 88/166 53%, Gaps = 13/166 7%
Query  1    MKAVFLTLL-FGLVCT----AQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYY 55
            MK ++L  L + LVC     A  T    +  KI GEW  I  A+D ++KI + G +R + 
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  56   RRIECINDCESLSITFYLKDQGTCLLLTEVA-KRQEGYVYVLEFYGTNTLEVIHVS-ENM 113
             +I  + +  SL + F+      C  L+ VA K ++   Y + + G NT+ +     +N 
Sbjct  61   EQIHVLEN--SLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNF 118
Query  114  LVTYVENY-DGERITKMTEGL-AKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            L+ ++ N  DGE    M  GL  +   ++ +  E++ QL  E G+  ENI +L   + C
Sbjct  119  LMAHLINEKDGETFQLM--GLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC 175

Sequence Alignment: 14. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 52.8 bits 201,  Expect = 6e-09
 Identities = 52/166 31%, Positives = 88/166 53%, Gaps = 13/166 7%
Query  1    MKAVFLTLL-FGLVCT----AQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYY 55
            MK ++L  L + LVC     A  T    +  KI GEW  I  A+D ++KI + G +R + 
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  56   RRIECINDCESLSITFYLKDQGTCLLLTEVA-KRQEGYVYVLEFYGTNTLEVIHVS-ENM 113
             +I  +   +SL + F+      C  L+ VA K ++   Y + + G NT+ +     +N 
Sbjct  61   EQIHVLE--KSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNF 118
Query  114  LVTYVENY-DGERITKMTEGL-AKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170
            L+ ++ N  DGE    M  GL  +   ++ +  E++ +L  E G+  ENI +L   + C
Sbjct  119  LMAHLINEKDGETFQLM--GLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRC 175

Sequence Alignment: 15. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 35.3 bits 124,  Expect = 0.001
 Identities = 45/165 27%, Positives = 76/165 46%, Gaps = 13/165 7%
Query  1    MKAVFLTLLFGLVCT--AQETPAE-IDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRR 57
            MK ++LT+ F L+    AQ+TPA   D   + G+W   Y  A   D+ V   P  +    
Sbjct  1    MKTLLLTIGFSLIAILQAQDTPALGKDTVAVSGKW---YLKAMTADQEVPEKP-DSVTPM 56
Query  58   IECINDCESLSITFYLKDQGTCLLLTEVA-KRQEGYVYVLEFYGTNTLEVIHVS--ENML 114
            I       +L     +   G C  +T V  K  E   Y    Y    +  I+ S   +  
Sbjct  57   ILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTA--YEGQRVVFIQPSPVRDHY 114
Query  115  VTYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 172
            + Y E     R  +M + L +    + E LE +++++  +G+ N+ I  L +++ C P
Sbjct  115  ILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGL-NQEILELAQSETCSP 171

Sequence Alignment: 16. Allergen Name: Equ c 2 Sequence ID: P81216

 Score = 29.9 bits 83,  Expect = 0.008
 Identities = 13/29 44%, Positives = 17/29 58%, Gaps = 0/29 0%
Query  16   AQETPAEIDPSKIPGEWRIIYAAADNKDK 44
            +Q   +E D S++ GEW  IY AA N  K
Sbjct  1    SQXPQSETDYSQLSGEWNTIYGAASNIXK 29

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.