The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL
GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAIS
TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM
SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P30941 Sola t 4 221 1493 421.3 1.2e-119
CAA45723 Sola t 4 217 1452 409.9 3.1e-116
P16348 Sola t 2 188 902 257.1 2.8e-70
P20347 Sola t 3.0102 222 267 80.4 5.1e-17
O24383 Sola t 3.0101 186 192 59.6 7.5e-11
AAB23464 Gly m TI 216 138 44.5 3.1e-06
CAA45777 Gly m TI 217 138 44.5 3.1e-06
P01071 Gly m TI 181 129 42.1 1.4e-05
CAA45778 Gly m TI 217 129 42.0 1.8e-05
AAB23483 Gly m TI 204 124 40.7 4.2e-05
CAA56343 Gly m TI 208 123 40.4 5.3e-05
AAB23482 Gly m TI 203 116 38.4 0.0002
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 421.3 bits 1493,  Expect = 1e-119
 Identities = 221/221 100%, Positives = 221/221 100%, Gaps = 0/221 0%
Query  1    MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL 60
            MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL
Sbjct  1    MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL 60
Query  61   GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAIS 120
            GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAIS
Sbjct  61   GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAIS 120
Query  121  TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM 180
            TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM
Sbjct  121  TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM 180
Query  181  SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ 221
            SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ
Sbjct  181  SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ 221

Sequence Alignment: 2. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 409.9 bits 1452,  Expect = 3e-116
 Identities = 217/217 100%, Positives = 217/217 100%, Gaps = 4/217 1%
Query  1    MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL 60
            MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL
Sbjct  1    MKCLFLLCLCLVPIVVFSSTFTSKNPINLPSDATPVLDVAGKELDSRLSYRIISTFWGAL 60
Query  61   GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAIS 120
            GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRF    SHFGQGIFENELLNIQFAIS
Sbjct  61   GGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRF----SHFGQGIFENELLNIQFAIS 116
Query  121  TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM 180
            TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM
Sbjct  117  TSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTM 176
Query  181  SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ 221
            SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ
Sbjct  177  SCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ 217

Sequence Alignment: 3. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 257.1 bits 902,  Expect = 3e-70
 Identities = 138/182 75%, Positives = 152/182 83%, Gaps = 4/182 2%
Query  35   PVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPV 94
            PVLD  GKEL+   SYRIIS   GALGGDVYLGKSPNSDAPC +G+FRYNSDVGPSGTPV
Sbjct  7    PVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPV 66
Query  95   RFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQA 154
            RFI  S     GIFE++LLNIQF I+T KLCVSYTIWKVG+ +A + TMLLETGGTIGQA
Sbjct  67   RFIPLSG----GIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQA 122
Query  155  DSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLD 214
            DSS+FKIVK S FGYNLLYCP+T    CPF  DD FC KVGVV QNGKRRLALV +NPLD
Sbjct  123  DSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLD 182
Query  215  VSFKQV 220
            V F++V
Sbjct  183  VLFQEV 188

Sequence Alignment: 4. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 80.4 bits 267,  Expect = 5e-17
 Identities = 76/191 39%, Positives = 111/191 58%, Gaps = 40/191 20%
Query  5    FLLCLCLVPIVVFSSTFTSKNPINLPS----DATPVL----DVAGKELDSRLSYRIISTF 56
            FLL    + +V F+ +FTS+NPI LP+    D   VL    D  G  L     Y I + +
Sbjct  9    FLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPL 68
Query  57   WGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTPVRFIGSS-SHFGQGIFENELL 113
             GA  G VYL    N    C N ++++ S       GTPV F+  S S +G  +    ++
Sbjct  69   LGA--GAVYLYNIGNLQ--CPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVV 124
Query  114  NIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKS-------SQ 166
             I+F + T+KLCV  T+WKV D        L+ TGG +G  ++  FKI+K+       S+
Sbjct  125  YIKFFVKTTKLCVDQTVWKVND------EQLVVTGGKVGN-ENDIFKIMKTDLVTPGGSK 177
Query  167  FGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSF 217
            + Y LL+CP  S + C           +G   +NG  RL  V D+   + F
Sbjct  178  YVYKLLHCP--SHLGCK---------NIGGNFKNGYPRLVTVDDDKDFIPF 217

Sequence Alignment: 5. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 59.6 bits 192,  Expect = 8e-11
 Identities = 57/166 34%, Positives = 82/166 49%, Gaps = 19/166 11%
Query  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTP 93
            V D  G  L     Y I + + GA  G VYL    N    C N ++++ S       GTP
Sbjct  13   VYDQDGNPLRIGERYIIKNPLLGA--GAVYLDNIGN--LQCPNAVLQHMSIPQFLGKGTP 68
Query  94   VRFIGSS-SHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG 152
            V FI  S S +G  +     + I+F + T+KLCV  T+WKV +        L+ TGG +G
Sbjct  69   VVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNN------EQLVVTGGNVG 122
Query  153  QADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNP 212
              ++  FKI K+      +    V   + CP   +   C  +G   +NG  RL  V D  
Sbjct  123  N-ENDIFKIKKTDLVIRGMKN--VYKLLHCPSHLE---CKNIGSNFKNGYPRLVTVNDEK 176
Query  213  LDVSF 217
              + F
Sbjct  177  DFIPF 181

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 44.5 bits 138,  Expect = 3e-06
 Identities = 61/185 32%, Positives = 104/185 56%, Gaps = 40/185 21%
Query  4    LFLLCLCLVPIVVFSSTFTSKNPINLPSD-ATPVLDVAGKELDSRLSYRIISTFWGALGG 62
            LFL+C        F++++       LPS  A  VLD  G  L++  +Y I+S    A+GG
Sbjct  8    LFLFC-------AFTTSY-------LPSAIADFVLDNEGNPLENGGTYYILSDI-TAFGG 52
Query  63   DVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQF-AIST 121
               +  +P  +  C   + +  +++      +  I SS +  + I E   L+++F + + 
Sbjct  53   ---IRAAPTGNERCPLTVVQSRNELDKG---IGTIISSPYRIRFIAEGHPLSLKFDSFAV 106
Query  122  SKLCVSY-TIWKVGDYDASLGTMLLETGGTIGQADSSWFKI--VKSSQFG-YNLLYCPVT 177
              LCV   T W V + D   G  +    G    A   WF++  V   +F  Y L++CP  
Sbjct  107  IMLCVGIPTEWSVVE-DLPEGPAV--KIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQ 163
Query  178  STMSCPFSSDDQFCLKVGVV--HQNGKRRLALVKDNPLDVSFKQV 220
            +        DD+ C  +G+   H +G RRL + K+ PL V F+++
Sbjct  164  A-------EDDK-CGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 200

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 44.5 bits 138,  Expect = 3e-06
 Identities = 61/185 32%, Positives = 104/185 56%, Gaps = 40/185 21%
Query  4    LFLLCLCLVPIVVFSSTFTSKNPINLPSD-ATPVLDVAGKELDSRLSYRIISTFWGALGG 62
            LFL+C        F++++       LPS  A  VLD  G  L++  +Y I+S    A+GG
Sbjct  9    LFLFC-------AFTTSY-------LPSAIADFVLDNEGNPLENGGTYYILSDI-TAFGG 53
Query  63   DVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQF-AIST 121
               +  +P  +  C   + +  +++      +  I SS +  + I E   L+++F + + 
Sbjct  54   ---IRAAPTGNERCPLTVVQSRNELDKG---IGTIISSPYRIRFIAEGHPLSLKFDSFAV 107
Query  122  SKLCVSY-TIWKVGDYDASLGTMLLETGGTIGQADSSWFKI--VKSSQFG-YNLLYCPVT 177
              LCV   T W V + D   G  +    G    A   WF++  V   +F  Y L++CP  
Sbjct  108  IMLCVGIPTEWSVVE-DLPEGPAV--KIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQ 164
Query  178  STMSCPFSSDDQFCLKVGVV--HQNGKRRLALVKDNPLDVSFKQV 220
            +        DD+ C  +G+   H +G RRL + K+ PL V F+++
Sbjct  165  A-------EDDK-CGDIGISIDHDDGTRRLVVSKNKPLVVQFQKL 201

Sequence Alignment: 8. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 42.1 bits 129,  Expect = 1e-05
 Identities = 53/166 31%, Positives = 86/166 51%, Gaps = 27/166 16%
Query  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPS-GTPV 94
            VLD  G  L +  +Y I+S    A+GG   +  +P  +  C   + +  +++    GT +
Sbjct  3    VLDNEGNPLSNGGTYYILSDI-TAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 58
Query  95   RFIGSSSHFGQGIFENELLNIQF-AISTSKLCVSY-TIWKVGDYDASLGTMLLETGGTIG 152
                SS    + I E   L ++F + +   LCV   T W V + D   G  +    G   
Sbjct  59   ----SSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVE-DLPEGPAV--KIGENK 111
Query  153  QADSSWFKI--VKSSQFG-YNLLYCPVTSTMSCPFSSDDQFCLKVGVV--HQNGKRRLAL 207
             A   WF+I  V   +F  Y L++C           ++D  C  +G+   H +G RRL +
Sbjct  112  DAVDGWFRIERVSDDEFNNYKLVFCTQ--------QAEDDKCGDIGISIDHDDGTRRLVV 163
Query  208  VKDNPLDVSFKQV 220
             K+ PL V F++V
Sbjct  164  SKNKPLVVQFQKV 176

Sequence Alignment: 9. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 42.0 bits 129,  Expect = 2e-05
 Identities = 64/185 34%, Positives = 101/185 54%, Gaps = 40/185 21%
Query  4    LFLLCLCLVPIVVFSSTFTSKNPINLPSD-ATPVLDVAGKELDSRLSYRIISTFWGALGG 62
            LFL+C        F++++       LPS  A  VLD  G  LDS  +Y I+S    A+GG
Sbjct  9    LFLFC-------AFTTSY-------LPSAIADFVLDNEGNPLDSGGTYYILSDI-TAFGG 53
Query  63   DVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQF-AIST 121
               +  +P  +  C   + +  +++      +  I SS    + I E   L ++F + + 
Sbjct  54   ---IRAAPTGNERCPLTVVQSRNELDKG---IGTIISSPFRIRFIAEGNPLRLKFDSFAV 107
Query  122  SKLCVSY-TIWKVGDYDASLGTMLLETGGTIGQADSSWFKI--VKSSQFG-YNLLYCPVT 177
              LCV   T W V + D   G  +    G    A   WF+I  V   +F  Y L++C   
Sbjct  108  IMLCVGIPTEWSVVE-DLPEGPAV--KIGENKDAVDGWFRIERVSDDEFNNYKLVFCTQQ 164
Query  178  STMSCPFSSDDQFCLKVGVV--HQNGKRRLALVKDNPLDVSFKQV 220
            +        DD+ C  +G+   H +G RRL + K+ PL V F++V
Sbjct  165  A-------EDDK-CGDIGISIDHDDGTRRLVVSKNKPLVVQFQKV 201

Sequence Alignment: 10. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 40.7 bits 124,  Expect = 4e-05
 Identities = 53/171 30%, Positives = 85/171 49%, Gaps = 28/171 16%
Query  29   LPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIF----RY 83
            LPS  A  VLD     L +  +Y ++    G  GG    G S   +  C   +     ++
Sbjct  20   LPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKSGG--IEGNSTGKEI-CPLTVVQSPNKH 76
Query  84   NSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQF-AISTSKLC-VSYTIWKVGDYDASLG 141
            N  +G       ++  S      I E   L+I+F + +   LC V  T W + + +  L 
Sbjct  77   NKGIG-------LVFKSPLHALFIAERYPLSIKFDSFAVIPLCGVMPTKWAIVEREG-LQ 128
Query  142  TMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGV-VHQN 200
             + L    T+      WF I + S+  YN  Y      + CP  ++D  C  +G+ +  +
Sbjct  129  AVTLAARDTV----DGWFNIERVSRE-YNDYY----KLVFCPQEAEDNKCEDIGIQIDND 179
Query  201  GKRRLALVKDNPLDVSFKQ 219
            G RRL L K+ PL V F++
Sbjct  180  GIRRLVLSKNKPLVVEFQK 198

Sequence Alignment: 11. Allergen Name: Gly m TI Sequence ID: CAA56343

 Score = 40.4 bits 123,  Expect = 5e-05
 Identities = 52/187 27%, Positives = 92/187 49%, Gaps = 37/187 19%
Query  4    LFLLCLCLVPIVVFSSTFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGG 62
            LFLLC        ++S++        PS  A  V+D  G  + +  +Y ++    G  GG
Sbjct  9    LFLLC-------ALTSSYQ-------PSATADIVFDTEGNPIRNGGTYYVLPVIRGK-GG 53
Query  63   DVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS 122
             + + K+     P    + +   +    G P+  I SS      I E  +L+++F + T 
Sbjct  54   GIEFAKTETETCPLT--VVQSPFEGLQRGLPL--IISSPFKILDITEGLILSLKFHLCTP 109
Query  123  KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFG--YNLLYCPVTSTM 180
               +S   + V  Y              + + +  WF+I ++S     Y L++C      
Sbjct  110  ---LSLNSFSVDRYSQGSARRTPCQTHWLQKHNRCWFRIQRASSESNYYKLVFCT----- 161
Query  181  SCPFSSDDQFCLK-VGVVHQNGKRRLALVKD--NPLDVSFKQVQ 221
                S+DD  C   V  + + G R L +  D  +PL V F++V+
Sbjct  162  ----SNDDSSCGDIVAPIDREGNRPLIVTHDQNHPLLVQFQKVE 201

Sequence Alignment: 12. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 38.4 bits 116,  Expect = 0.0002
 Identities = 47/172 27%, Positives = 85/172 49%, Gaps = 25/172 14%
Query  29   LPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDV 87
            LPS  A  VLD     L +  +Y ++    G  GG + +  +      C   + +  +++
Sbjct  20   LPSATAQFVLDTDDDPLQNGGTYYMLPVMRGK-GGGIEVDST--GKEICPLTVVQSPNEL 76
Query  88   GPSGTPVRFIGSSSHFGQGIFENELLNIQF-AISTSKLCVSY-TIWKVGDYDASLGTMLL 145
                  + ++ +S      I E   L+I+F + +   LC    T W + + +  L  + L
Sbjct  77   DKG---IGLVFTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWAIVEREG-LQAVKL 132
Query  146  ETGGTIGQADSSWFKIVKSSQF--GYNLLYCPVTSTMSCPFSSDDQFCLKVGV-VHQNGK 202
                T+      WF I + S+    Y L++CP          ++D  C  +G+ +  +G 
Sbjct  133  AARDTV----DGWFNIERVSREYNDYKLVFCPQ--------QAEDNKCEDIGIQIDDDGI 180
Query  203  RRLALVKDNPLDVSFKQ 219
            RRL L K+ PL V F++
Sbjct  181  RRLVLSKNKPLVVQFQK 197

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.