The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY
KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL
IKKLDELAKKVKAVNPDEYY
Sequence Info Allergen Name Length Opt Bits Score E Value
ABC73706 Der p 21.0101 140 877 233.0 2.3e-63
B2GM84 Der f 21.0101 136 615 165.5 4.6e-43
AAQ73494 Lep d 5.0103 169 332 92.6 5e-21
AAQ73493 Lep d 5.0102 171 332 92.6 5.1e-21
Q9U5P2 Lep d 5.0101 110 328 91.7 6.3e-21
ABH06348 Blo t 21.0101 129 312 87.5 1.3e-19
ABH06344 Blo t 21.0101 129 311 87.3 1.6e-19
ABH06347 Blo t 21.0101 129 311 87.3 1.6e-19
ABH06350 Blo t 21.0101 129 306 86.0 3.8e-19
ABH06346 Blo t 21.0101 129 306 86.0 3.8e-19
O96870 Blo t 5 134 305 85.7 4.8e-19
ABO84970 Der f 5.0101 132 268 76.2 3.5e-16
P14004 Der p 5.0102 132 245 70.3 2.1e-14
CAA35692 Der p 5.0101 148 245 70.3 2.4e-14
AAB32842 Der p 5.0102 132 243 69.8 3e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 21.0101 Sequence ID: ABC73706

 Score = 233.0 bits 877,  Expect = 2e-63
 Identities = 140/140 100%, Positives = 140/140 100%, Gaps = 0/140 0%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY
Sbjct  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
            KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL
Sbjct  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
Query  121  IKKLDELAKKVKAVNPDEYY 140
            IKKLDELAKKVKAVNPDEYY
Sbjct  121  IKKLDELAKKVKAVNPDEYY 140

Sequence Alignment: 2. Allergen Name: Der f 21.0101 Sequence ID: B2GM84

 Score = 165.5 bits 615,  Expect = 5e-43
 Identities = 98/136 72%, Positives = 116/136 85%, Gaps = 2/136 1%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII  F AIVMA +VSGFIV    ED+WR AFD ++MEE+E K+DQ+E GLL LSEQY
Sbjct  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
            KELEKTKSKELKEQILRELTI EN+++GALKF + EAKRTDLNMFERYN+E A+ +I++L
Sbjct  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
Query  121  IKKLDELAKKVKAVNPDE 138
            +K L ELAKKVKAV  D+
Sbjct  119  VKDLAELAKKVKAVKSDD 136

Sequence Alignment: 3. Allergen Name: Lep d 5.0103 Sequence ID: AAQ73494

 Score = 92.6 bits 332,  Expect = 5e-21
 Identities = 55/107 51%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  28   DEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMK 87
            DE+R  FDRL++   E +  ++E+ L HLS Q  ELEK+KSKELK QILRE++IG +F+ 
Sbjct  60   DEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFID 119
Query  88   GALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAV 134
             A   FE E KR DLN+ E++N+E AL +  +L K L  LA KVKA+
Sbjct  120  SAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAI 166
 Score = 41.1 bits 132,  Expect = 2e-05
 Identities = 22/53 41%, Positives = 32/53 60%, Gaps = 0/53 0%
Query  86   MKGALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPDE 138
            M G    ++ E KRTDLN +E++N +     + +L K+L E+ K VKAV  DE
Sbjct  1    MTGVKTHLQHELKRTDLNFLEKFNLDEITAPLNVLTKELTEVQKHVKAVESDE 53

Sequence Alignment: 4. Allergen Name: Lep d 5.0102 Sequence ID: AAQ73493

 Score = 92.6 bits 332,  Expect = 5e-21
 Identities = 55/107 51%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  28   DEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMK 87
            DE+R  FDRL++   E +  ++E+ L HLS Q  ELEK+KSKELK QILRE++IG +F+ 
Sbjct  62   DEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFID 121
Query  88   GALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAV 134
             A   FE E KR DLN+ E++N+E AL +  +L K L  LA KVKA+
Sbjct  122  SAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAI 168
 Score = 42.9 bits 139,  Expect = 5e-06
 Identities = 23/53 43%, Positives = 33/53 62%, Gaps = 0/53 0%
Query  86   MKGALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPDE 138
            M G    +E E KRTDLN +E++N +    ++ +L K+L E+ K VKAV  DE
Sbjct  1    MTGVKTHLEHELKRTDLNFLEKFNLDEITATLNVLTKELTEVQKHVKAVESDE 53

Sequence Alignment: 5. Allergen Name: Lep d 5.0101 Sequence ID: Q9U5P2

 Score = 91.7 bits 328,  Expect = 6e-21
 Identities = 54/107 50%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  28   DEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMK 87
            D++R  FDRL++   E +  ++E+ L HLS Q  ELEK+KSKELK QILRE++IG +F+ 
Sbjct  1    DDFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFID 60
Query  88   GALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAV 134
             A   FE E KR DLN+ E++N+E AL +  +L K L  LA KVKA+
Sbjct  61   SAKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAI 107

Sequence Alignment: 6. Allergen Name: Blo t 21.0101 Sequence ID: ABH06348

 Score = 87.5 bits 312,  Expect = 1e-19
 Identities = 53/126 42%, Positives = 87/126 69%, Gaps = 6/126 4%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIINTATQRFHEIEKFLLHITHEV 54
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
             +LEKT +K+ K ++LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  55   DDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
Query  121  IKKLDELAKKVK 132
            +K L  L K+V+
Sbjct  115  LKDLKALQKRVQ 126

Sequence Alignment: 7. Allergen Name: Blo t 21.0101 Sequence ID: ABH06344

 Score = 87.3 bits 311,  Expect = 2e-19
 Identities = 53/126 42%, Positives = 87/126 69%, Gaps = 6/126 4%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIVNTATQRFHEIEKFLLHITHEV 54
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
             +LEKT +K+ K ++LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  55   DDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
Query  121  IKKLDELAKKVK 132
            +K L  L K+V+
Sbjct  115  LKDLKALQKRVQ 126

Sequence Alignment: 8. Allergen Name: Blo t 21.0101 Sequence ID: ABH06347

 Score = 87.3 bits 311,  Expect = 2e-19
 Identities = 53/126 42%, Positives = 87/126 69%, Gaps = 6/126 4%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIVNAATQRFHEIEKFLLHITHEV 54
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
             +LEKT +K+ K ++LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  55   DDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
Query  121  IKKLDELAKKVK 132
            +K L  L K+V+
Sbjct  115  LKDLKALQKRVQ 126

Sequence Alignment: 9. Allergen Name: Blo t 21.0101 Sequence ID: ABH06350

 Score = 86.0 bits 306,  Expect = 4e-19
 Identities = 52/126 41%, Positives = 87/126 69%, Gaps = 6/126 4%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIVNTATQRFHEIEKFLLHITHEV 54
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
             +LE+T +K+ K ++LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  55   DDLEETGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
Query  121  IKKLDELAKKVK 132
            +K L  L K+V+
Sbjct  115  LKDLKALQKRVQ 126

Sequence Alignment: 10. Allergen Name: Blo t 21.0101 Sequence ID: ABH06346

 Score = 86.0 bits 306,  Expect = 4e-19
 Identities = 53/126 42%, Positives = 86/126 68%, Gaps = 6/126 4%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII L A I +A A+    V +   D +R  FD +++     +  ++EK LLH++ + 
Sbjct  1    MKFIIALAALIAVACALP---VSN---DNFRHEFDHMIVNTATQRFHEIEKFLLHITHEV 54
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
             +LEKT +K+ K + LRELT+ E F++G+  +F+ E KRTDL+++E++N+E AL +  LL
Sbjct  55   DDLEKTGNKDEKARPLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLL 114
Query  121  IKKLDELAKKVK 132
            +K L  L K+V+
Sbjct  115  LKDLKALQKRVQ 126

Sequence Alignment: 11. Allergen Name: Blo t 5 Sequence ID: O96870

 Score = 85.7 bits 305,  Expect = 5e-19
 Identities = 59/128 46%, Positives = 84/128 65%, Gaps = 9/128 7%
Query  1    MKFIITL---FAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLS 57
            MKF I L   FAA V+A           K+D++R  FD L++E+    I++ E  LL+L 
Sbjct  1    MKFAIVLIACFAASVLAQE------HKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQ 54
Query  58   EQYKELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESI 117
             Q  EL + KSKEL+E+I+REL +    ++GA   +E E KRTDLN++ER+NYE A    
Sbjct  55   HQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLS 114
Query  118  KLLIKKLDELAKKVKAV 134
            K+L+K L E  +KVK +
Sbjct  115  KILLKDLKETEQKVKDI 131

Sequence Alignment: 12. Allergen Name: Der f 5.0101 Sequence ID: ABO84970

 Score = 76.2 bits 268,  Expect = 3e-16
 Identities = 48/130 36%, Positives = 81/130 62%, Gaps = 4/130 3%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII +  A+   A V   + G+ K+ +++  FD L+M+ +  ++ + E+ LLHL  Q 
Sbjct  1    MKFIIAI--AVCTLAVVC--VSGEPKKHDYQNEFDFLLMQRIHEQMRKGEEALLHLQHQI 56
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
              +E+  +KE+KEQIL E+     ++ G    +    KRTDL++FERYN E AL+S ++L
Sbjct  57   NTFEENPTKEMKEQILGEMDTIIALIDGVRGVLNRLMKRTDLDIFERYNVEIALKSNEIL 116
Query  121  IKKLDELAKKVKAV 134
             + L +  ++VK +
Sbjct  117  ERDLKKEEQRVKKI 130

Sequence Alignment: 13. Allergen Name: Der p 5.0102 Sequence ID: P14004

 Score = 70.3 bits 245,  Expect = 2e-14
 Identities = 46/130 35%, Positives = 77/130 59%, Gaps = 4/130 3%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII +F A +    VSG    DKK D ++  FD L+ME +  +I + E  L++L EQ 
Sbjct  1    MKFIIAFFVATLAVMTVSGE---DKKHD-YQNEFDFLLMERIHEQIKKGELALFYLQEQI 56
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
              +E+  +KE+K++I+ E+      + G    ++   +R DL++FE+YN E A +S  +L
Sbjct  57   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 116
Query  121  IKKLDELAKKVKAV 134
             + L +   +VK +
Sbjct  117  ERDLKKEEARVKKI 130

Sequence Alignment: 14. Allergen Name: Der p 5.0101 Sequence ID: CAA35692

 Score = 70.3 bits 245,  Expect = 2e-14
 Identities = 46/130 35%, Positives = 77/130 59%, Gaps = 4/130 3%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII +F A +    VSG    DKK D ++  FD L+ME +  +I + E  L++L EQ 
Sbjct  17   MKFIIAFFVATLAVMTVSGE---DKKHD-YQNEFDFLLMERIHEQIKKGELALFYLQEQI 72
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
              +E+  +KE+K++I+ E+      + G    ++   +R DL++FE+YN E A +S  +L
Sbjct  73   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 132
Query  121  IKKLDELAKKVKAV 134
             + L +   +VK +
Sbjct  133  ERDLKKEEARVKKI 146

Sequence Alignment: 15. Allergen Name: Der p 5.0102 Sequence ID: AAB32842

 Score = 69.8 bits 243,  Expect = 3e-14
 Identities = 46/130 35%, Positives = 76/130 58%, Gaps = 4/130 3%
Query  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
            MKFII +F A +    VSG    DKK D ++  FD L+ME +  +I + E  L++L EQ 
Sbjct  1    MKFIIAFFVATLAVMTVSGE---DKKHD-YQNEFDFLLMERIHEQIKKGELALFYLQEQI 56
Query  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
              +E   +KE+K++I+ E+      + G    ++   +R DL++FE+YN E A +S  +L
Sbjct  57   NHFEAKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 116
Query  121  IKKLDELAKKVKAV 134
             + L +   +VK +
Sbjct  117  ERDLKKEEARVKKI 130

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.