The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD
TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK
LLATGEHGVLACGAVNTDVKP
Sequence Info Allergen Name Length Opt Bits Score E Value
O02380 Tyr p 2 141 928 224.1 1.1e-60
A6XEN9 Blo t 2.0104 142 538 132.9 3.3e-33
A6XEN8 Blo t 2.0104 142 535 132.2 5.3e-33
A6XEP1 Blo t 2.0104 142 529 130.8 1.4e-32
A6XEP6 Blo t 2.0104 142 529 130.8 1.4e-32
A6XEP2 Blo t 2.0104 142 529 130.8 1.4e-32
A6XEP3 Blo t 2.0104 142 528 130.5 1.7e-32
A6XEP5 Blo t 2.0104 142 522 129.1 4.4e-32
CAA58755 Lep d 2.0201 141 520 128.7 6e-32
CAD32314 Lep d 2.0202 141 520 128.7 6e-32
A6XEP4 Blo t 2.0104 142 520 128.7 6.1e-32
A6XEP0 Blo t 2.0104 142 519 128.4 7.1e-32
AAQ73482 Blo t 2.0102 142 512 126.8 2.2e-31
AAQ73483 Blo t 2.0101 144 510 126.3 3.1e-31
P80384 Lep d 2 141 498 123.5 2.1e-30
CAD32313 Lep d 2.0102 141 496 123.0 2.9e-30
BAX34757 Der f 35.0101 143 464 115.6 5.4e-28
CAB76459 Gly d 2.0201 125 446 111.4 8.5e-27
AAQ73481 Blo t 2.0103 141 445 111.1 1.1e-26
Q00855 Der f 2 146 413 103.6 2.1e-24
CAB59976 Gly d 2.0101 128 410 103.0 3e-24
BAA01241 Der f 2 138 404 101.5 8.6e-24
BAA01239 Der f 2 138 402 101.1 1.2e-23
CAK22338 Der p 2.0114 146 399 100.3 2.1e-23
P49278 Der p 2 146 389 98.0 1.1e-22
Q9TZZ2 Eur m 2 145 377 95.2 7.3e-22
ABA39438 Der f 2.0109 129 373 94.3 1.2e-21
ABA39437 Der p 2.0109 129 364 92.2 5.2e-21
CAQ68249 Der p 2.0115 129 362 91.7 7.2e-21
AAC82350 Eur m 2.0102 135 362 91.7 7.6e-21
AAK30133 Der f 2 170 355 90.0 3.1e-20
CAA57160 Lep d 2.0101 98 319 81.7 5.6e-18
ABG76195 Der f 22.0101 155 252 65.9 5e-13
Q28895 Can f 7.0101 149 237 62.4 5.4e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 224.1 bits 928,  Expect = 1e-60
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 0/141 0%
Query  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
            MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD
Sbjct  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
            TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
Query  121  LLATGEHGVLACGAVNTDVKP 141
            LLATGEHGVLACGAVNTDVKP
Sbjct  121  LLATGEHGVLACGAVNTDVKP 141

Sequence Alignment: 2. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 132.9 bits 538,  Expect = 3e-33
 Identities = 73/138 52%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +NG+EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+V+PN+KTV   
Sbjct  63   EKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 3. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 132.2 bits 535,  Expect = 5e-33
 Identities = 72/138 52%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +NG+EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 4. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 130.8 bits 529,  Expect = 1e-32
 Identities = 71/138 51%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 5. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 130.8 bits 529,  Expect = 1e-32
 Identities = 71/138 51%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 6. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 130.8 bits 529,  Expect = 1e-32
 Identities = 71/138 51%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 130.5 bits 528,  Expect = 2e-32
 Identities = 70/138 50%, Positives = 99/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KT+   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTITTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 129.1 bits 522,  Expect = 4e-32
 Identities = 71/138 51%, Positives = 97/138 70%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ A AG VKFTDC   E+ S+ +  C GD C IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +NG+EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+V+PN+KTV   
Sbjct  63   EKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 9. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 128.7 bits 520,  Expect = 6e-32
 Identities = 68/140 48%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQD 61
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
            T K+ +KV  ++ G  + +PG+ETDGCKVLKCP+KKG     NY + +P++ P IK  V 
Sbjct  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADVT 121
Query  121  LLATGEHGVLACGAVNTDVK 140
                G+HGV+ACG ++  V+
Sbjct  122  AELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 10. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 128.7 bits 520,  Expect = 6e-32
 Identities = 68/140 48%, Positives = 97/140 69%, Gaps = 0/140 0%
Query  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQD 61
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
            T K+ +KV  ++ G  + +PG+ETDGCKVLKCP+KKG     NY + +P++ P IK  V 
Sbjct  62   TNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDVT 121
Query  121  LLATGEHGVLACGAVNTDVK 140
                G+HGV+ACG ++  V+
Sbjct  122  AELVGDHGVMACGTIHGQVE 141

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 128.7 bits 520,  Expect = 6e-32
 Identities = 70/138 50%, Positives = 98/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC  D C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 128.4 bits 519,  Expect = 7e-32
 Identities = 70/138 50%, Positives = 98/138 71%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AAAG VKFTDC   E+ S+ + GC GD C+I K K   +   F ANQD+
Sbjct  3    KFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 13. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 126.8 bits 512,  Expect = 2e-31
 Identities = 69/138 50%, Positives = 97/138 70%, Gaps = 0/138 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+ AA G VKFT C   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 62
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  63   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 122
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  123  SLVGDHGVVACGKVNTEV 140

Sequence Alignment: 14. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 126.3 bits 510,  Expect = 3e-31
 Identities = 68/136 50%, Positives = 97/136 71%, Gaps = 0/136 0%
Query  4    LILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCK 63
            L L+ + + AAAG VKFTDC   E+ S+ + GC GD C+IHK K   +   F ANQD+ K
Sbjct  7    LALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEK 66
Query  64   IEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLA 123
            +E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV     
Sbjct  67   LEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASL 126
Query  124  TGEHGVLACGAVNTDV 139
             G+HGV+ACG VNT+V
Sbjct  127  VGDHGVVACGKVNTEV 142

Sequence Alignment: 15. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 123.5 bits 498,  Expect = 2e-30
 Identities = 66/140 47%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQD 61
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
            T K+ +KV  ++ G  + +PG+ETDGCK +KCP+KKG      YS  +P++ P +K  V 
Sbjct  62   TAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVT 121
Query  121  LLATGEHGVLACGAVNTDVK 140
                G+HGV+ACG V+  V+
Sbjct  122  AELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 16. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 123.0 bits 496,  Expect = 3e-30
 Identities = 66/140 47%, Positives = 95/140 67%, Gaps = 0/140 0%
Query  1    MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQD 60
            MKF+ LFALVAVA+AG++ F DCG  E+  + + GC GD CVIH+ + + + A+F ANQD
Sbjct  2    MKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQD 61
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
            T K+ +KV  ++ G  + +PG+ETDGCK +KCP+KKG      YS  +P++ P +K  V 
Sbjct  62   TAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVT 121
Query  121  LLATGEHGVLACGAVNTDVK 140
                G+HGV+ACG V+  V+
Sbjct  122  AELIGDHGVMACGTVHGQVE 141

Sequence Alignment: 17. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 115.6 bits 464,  Expect = 5e-28
 Identities = 60/139 43%, Positives = 97/139 69%, Gaps = 1/139 0%
Query  1    MKFLILFALV-AVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQ 59
            +KFL +FAL  AVA+AG++KF DCG KE+ S+ V GCEGD CV+HK K + +  +  +NQ
Sbjct  2    IKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSNQ 61
Query  60   DTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVV 119
            D+  +++ ++  +NG+E+ +PG + DGC  ++CP+ KG  Y + YS NVP+V+PNIK  +
Sbjct  62   DSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTL 121
Query  120  KLLATGEHGVLACGAVNTDV 139
                 G++G++ C  +N ++
Sbjct  122  TAKVIGDNGLVGCLKLNGEI 141

Sequence Alignment: 18. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 111.4 bits 446,  Expect = 8e-27
 Identities = 57/125 45%, Positives = 82/125 65%, Gaps = 0/125 0%
Query  16   GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
            G++KF DCGK E+  + +  C GD+CVIH+ KP+ + A+F ANQDT K  +KV  ++ G 
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAV 135
             + +PG+ETDGCK +KCP+KKG      Y+  VP+++P +K  V     G+HGVLACG  
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  136  NTDVK 140
               V+
Sbjct  121  GRQVE 125

Sequence Alignment: 19. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 111.1 bits 445,  Expect = 1e-26
 Identities = 62/137 45%, Positives = 91/137 66%, Gaps = 1/137 0%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            KF+ L  LV+        +  C   E+ S+ + GC GD C+IHK K   +   F ANQD+
Sbjct  3    KFICLALLVSSRRQRCQIYRSC-TWEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDS 61
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKL 121
             K+E+K++  +N +EVP+PG++ DGCK   CPLKKG KY ++YS+ +P+++PN+KTV   
Sbjct  62   EKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTA 121
Query  122  LATGEHGVLACGAVNTDV 139
               G+HGV+ACG VNT+V
Sbjct  122  SLVGDHGVVACGKVNTEV 139

Sequence Alignment: 20. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 103.6 bits 413,  Expect = 2e-24
 Identities = 65/136 47%, Positives = 88/136 64%, Gaps = 7/136 5%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
            K L L  LVA   A QV   DC   EI  V VDGC G D C+IH+ KP  + A F ANQ+
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
            T   ++++   L+GLE+ +PGI+T+ C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  118  VVKLLATGEHGVLACGAVNTDVK 140
             VKL+  G++GVLAC A+ T  K
Sbjct  124  TVKLI--GDNGVLAC-AIATHGK 143

Sequence Alignment: 21. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 103.0 bits 410,  Expect = 3e-24
 Identities = 56/125 44%, Positives = 85/125 68%, Gaps = 2/125 1%
Query  16   GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNG- 74
            G++ FTDCG  EI  ++V  C G+ CVIH+ KP+ + A+F ANQDT  + + +T  ++G 
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  75   LEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVN-VPSVVPNIKTVVKLLATGEHGVLACG 133
            + + IPG+ET+ CK++KCP++KG    + Y++  +P   P IK  VK    GEHGVLACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  134  AVNTDVK 140
             V+ +V+
Sbjct  121  WVDGEVQ 127

Sequence Alignment: 22. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 101.5 bits 404,  Expect = 9e-24
 Identities = 62/129 48%, Positives = 84/129 65%, Gaps = 7/129 5%
Query  9    LVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVK 67
            LVA   A QV   DC   EI  V VDGC G D C+IH+ KP  + A F ANQ+T   +++
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  68   VTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLAT 124
            +   L+GLE+ +PGI+T+ C  +KCPL KG +Y   Y+ NVP + P   N+   VKL+  
Sbjct  63   IKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV-- 120
Query  125  GEHGVLACGAVNTDVK 140
            G++GVLAC A+ T  K
Sbjct  121  GDNGVLAC-AIATHAK 135

Sequence Alignment: 23. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 101.1 bits 402,  Expect = 1e-23
 Identities = 62/129 48%, Positives = 85/129 65%, Gaps = 7/129 5%
Query  9    LVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVK 67
            LVA   A QV   DC   EI  V VDGC G D C+IH+ KP  + A F ANQ+T   +++
Sbjct  3    LVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIE 62
Query  68   VTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLAT 124
            +   L+GLE+ +PGI+T+ C  +KCPL KG +Y + Y+ NVP + P   N+   VKL+  
Sbjct  63   IKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI-- 120
Query  125  GEHGVLACGAVNTDVK 140
            G++GVLAC A+ T  K
Sbjct  121  GDNGVLAC-AIATHGK 135

Sequence Alignment: 24. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 100.3 bits 399,  Expect = 2e-23
 Identities = 63/136 46%, Positives = 88/136 64%, Gaps = 7/136 5%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
            K L L  LVA  AA QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ+
Sbjct  4    KILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQN 63
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
            T   ++++   ++GLEV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  64   TKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  118  VVKLLATGEHGVLACGAVNTDVK 140
             VK+L  G++GVLAC A+ T  K
Sbjct  124  TVKVL--GDNGVLAC-AIATHAK 143

Sequence Alignment: 25. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 98.0 bits 389,  Expect = 1e-22
 Identities = 61/136 44%, Positives = 86/136 63%, Gaps = 7/136 5%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
            K L L  LVA  A  QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ+
Sbjct  4    KILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQN 63
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
            T   ++++   ++GLEV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  64   TKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  118  VVKLLATGEHGVLACGAVNTDVK 140
             VK++  G+ GVLAC A+ T  K
Sbjct  124  TVKVM--GDDGVLAC-AIATHAK 143

Sequence Alignment: 26. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 95.2 bits 377,  Expect = 7e-22
 Identities = 60/136 44%, Positives = 87/136 63%, Gaps = 7/136 5%
Query  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
            K L L  LVA  AA QV   DC   EI  V V GC+G + CVIH+    ++ A F ANQ+
Sbjct  3    KILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQN 62
Query  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
            +   ++++   ++G+E+ +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  63   SNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVV 122
Query  118  VVKLLATGEHGVLACGAVNTDVK 140
             VKLL  G++GVLAC A+ T  K
Sbjct  123  TVKLL--GDNGVLAC-AIATHAK 142

Sequence Alignment: 27. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 94.3 bits 373,  Expect = 1e-21
 Identities = 58/121 47%, Positives = 80/121 66%, Gaps = 7/121 5%
Query  17   QVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
            QV   DC   EI  V VDG  G D C+IH+ KP  + A F ANQ+T   ++++   +NGL
Sbjct  2    QVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLAC 132
            EV +PGI+T+ C  +KCPL KG +Y + Y+ NVP + P   N+   VKL+  G++GVLAC
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI--GDNGVLAC 119
Query  133  GAVNTDVK 140
             A+ T  K
Sbjct  120  -AIATHAK 126

Sequence Alignment: 28. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 92.2 bits 364,  Expect = 5e-21
 Identities = 54/121 44%, Positives = 80/121 66%, Gaps = 7/121 5%
Query  17   QVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
            QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ++   ++++   ++GL
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLAC 132
            EV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+   VK+L  G++GVLAC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVL--GDNGVLAC 119
Query  133  GAVNTDVK 140
             A+ T  K
Sbjct  120  -AIATHAK 126

Sequence Alignment: 29. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 91.7 bits 362,  Expect = 7e-21
 Identities = 53/121 43%, Positives = 80/121 66%, Gaps = 7/121 5%
Query  17   QVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
            QV   DC   EI  V V GC G + C+IH+ KP ++ A F ANQ++   ++++   ++GL
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLAC 132
            EV +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+   VK++  G++GVLAC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVM--GDNGVLAC 119
Query  133  GAVNTDVK 140
             A+ T  K
Sbjct  120  -AIATHAK 126

Sequence Alignment: 30. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 91.7 bits 362,  Expect = 8e-21
 Identities = 56/128 43%, Positives = 83/128 64%, Gaps = 7/128 5%
Query  10   VAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKV 68
            VA  AA QV   DC   EI  V V GC+G + CVIH+    ++ A F ANQ++   ++++
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  69   TGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATG 125
               ++G+E+ +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+   VKLL  G
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLL--G 118
Query  126  EHGVLACGAVNTDVK 140
            ++GVLAC A+ T  K
Sbjct  119  DNGVLAC-AIATHAK 132

Sequence Alignment: 31. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 90.0 bits 355,  Expect = 3e-20
 Identities = 54/111 48%, Positives = 77/111 69%, Gaps = 7/111 6%
Query  27   EIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETD 85
            EI  V VDGC G D C+IH+ KP  + A F ANQ+T   ++++   L+GLE+ +PGI+T+
Sbjct  53   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 112
Query  86   GCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLACGAVNTDVK 140
             C  +KCPL KG +Y + Y+ NVP + P   N+   VKL+  G++GVLAC A+ T  K
Sbjct  113  ACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI--GDNGVLAC-AIATHGK 167

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 81.7 bits 319,  Expect = 6e-18
 Identities = 42/98 42%, Positives = 64/98 65%, Gaps = 0/98 0%
Query  43   IHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTM 102
            IH+ + + + A+F ANQDT K+ +KV  ++ G  + +PG+ETDGCK +KCP+KKG     
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  103  NYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVK 140
             YS  +P++ P +K  V     G+HGV+ACG V+  V+
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 98

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 65.9 bits 252,  Expect = 5e-13
 Identities = 56/138 40%, Positives = 79/138 57%, Gaps = 15/138 10%
Query  2    KFLIL-FALVAVAAAGQ-----VKFTDCGKKEIASVAVDGCEGDL--CVIHKSKPVHVIA 53
            +FLI+  AL  +AAA Q     V++ DCG  EI S  V G   +   CVIHK    ++  
Sbjct  3    RFLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRI 62
Query  54   EFTANQDT-CKIEVKVTGQLNGLEVPIPGIE-TDGCKV--LKCPLKKGTKYTMNYSVNVP 109
             F AN++T  KI  +    L G+E+  PGI+ TD C+   L CPL KG  Y  +   N+ 
Sbjct  63   SFVANENTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLG 122
Query  110  SVVP--NIKTVVKLLATGEHGVLACGAVNTDVK 140
              VP  N+   V+L   G  G L CG ++  ++
Sbjct  123  DDVPTANVTATVRL-ENGHGGDLLCGRMHISLQ 154

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 62.4 bits 237,  Expect = 5e-12
 Identities = 43/137 31%, Positives = 70/137 51%, Gaps = 4/137 2%
Query  4    LILFALVAVAAAGQVKFTDCGKKE--IASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDT 61
            ++L+AL  +   G V F DCG     I  + V+ C    C +HK +   V   FT+N  +
Sbjct  8    FLLLALGDLGPGGAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPS 67
Query  62   CKIEVKVTGQLNGLEVPIPGIETDGCKV-LKCPLKKGTKYTMNYSVNVPSVVPNIKTVVK 120
               +  V G + G+ VP P  E DGCK  + CP++K   Y+    + V +  P+IK VV+
Sbjct  68   QSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQ 127
Query  121  LLATGEHGV-LACGAVNTDVK 140
             +  G++   L C  +   ++
Sbjct  128  WMLLGDNNQHLFCWEIPVQIE 148

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.