The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG
KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF
NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL
Sequence Info Allergen Name Length Opt Bits Score E Value
P02222 Chi t 3 160 1039 244.0 1.5e-66
P02223 Chi t 6.0201 161 714 169.9 3e-44
P02226 Chi t 6.01 145 656 156.7 2.5e-40
P84298 Chi t 7 161 621 148.7 7.3e-38
P84299 Chi t 7 161 621 148.7 7.3e-38
P02224 Chi t 5 162 618 148.0 1.2e-37
P02227 Chi t 8 151 596 143.0 3.5e-36
P02221 Chi t 2.0101 158 538 129.8 3.5e-32
AAA80190 Chi t 2.0102 158 536 129.3 4.9e-32
P02228 Chi t 9 151 509 123.2 3.2e-30
P02229 Chi t 1.01 151 480 116.6 3.2e-28
P02230 Chi t 1.0201 151 441 107.7 1.5e-25
P02231 Chi t 4 151 280 71.0 1.7e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Chi t 3 Sequence ID: P02222

 Score = 244.0 bits 1039,  Expect = 2e-66
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG
Sbjct  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF
Sbjct  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL
Sbjct  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160

Sequence Alignment: 2. Allergen Name: Chi t 6.0201 Sequence ID: P02223

 Score = 169.9 bits 714,  Expect = 3e-44
 Identities = 103/160 64%, Positives = 130/160 81%, Gaps = 1/160 0%
Query  1    MKF-LVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFA 59
            MKF +VLALCI  A+A P+S+D+A+ +R SWA VKH+EVDIL  +F  +PDI A+FPQFA
Sbjct  1    MKFFIVLALCIVGAIADPVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFA 60
Query  60   GKDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQ 119
            GKDL ++K TG FATHAGRIVGF+SEIVAL+GN +N PAM TLI +++ +H  RGI K Q
Sbjct  61   GKDLASIKDTGAFATHAGRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQ 120
Query  120  FNEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            FNEFR+SLVSYL S  SWND+   AWT+GLDN+F M+F++L
Sbjct  121  FNEFRSSLVSYLSSHASWNDATADAWTHGLDNIFGMIFAHL 161

Sequence Alignment: 3. Allergen Name: Chi t 6.01 Sequence ID: P02226

 Score = 156.7 bits 656,  Expect = 2e-40
 Identities = 94/145 64%, Positives = 122/145 84%, Gaps = 0/145 0%
Query  16   APLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAGKDLETLKGTGQFATH 75
            APLSAD+ASLV+ +WAQV++SEV+IL  +F A PDI A+FPQFAGKD+ ++K TG FATH
Sbjct  1    APLSADQASLVKSTWAQVRNSEVEILAAVFTAYPDIQARFPQFAGKDVASIKDTGAFATH 60
Query  76   AGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLVSYLQSKV 135
            AGRIVGFVSEI+AL+GN +N PA++TL+  +AA+HKARGI +AQFNEFRA LVSY+ S V
Sbjct  61   AGRIVGFVSEIIALIGNESNAPAVQTLVGQLAASHKARGISQAQFNEFRAGLVSYVSSNV 120
Query  136  SWNDSLGAAWTQGLDNVFNMMFSYL 160
            +WN +  +AWT GLDN+F ++F+ L
Sbjct  121  AWNAAAESAWTAGLDNIFGLLFAAL 145

Sequence Alignment: 4. Allergen Name: Chi t 7 Sequence ID: P84298

 Score = 148.7 bits 621,  Expect = 7e-38
 Identities = 91/160 56%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MKFL-VLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFA 59
            MKF+ VLALCI  A+A+PL+ADEASLV+ SW  V H+EV+IL  +F A PDI  KF QFA
Sbjct  1    MKFFAVLALCIVGAIASPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFA 60
Query  60   GKDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQ 119
            GKDL ++K TG FATHA RIV F+SE++AL GN++N  A+ +L+  +  +HKARG+  AQ
Sbjct  61   GKDLASIKDTGAFATHATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQ 120
Query  120  FNEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            F EFR +LV+YLQ+ VSW D++ AAW + LDN F ++   L
Sbjct  121  FGEFRTALVAYLQANVSWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 5. Allergen Name: Chi t 7 Sequence ID: P84299

 Score = 148.7 bits 621,  Expect = 7e-38
 Identities = 91/160 56%, Positives = 120/160 75%, Gaps = 1/160 0%
Query  1    MKFL-VLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFA 59
            MKF+ VLALCI  A+A+PL+ADEASLV+ SW  V H+EV+IL  +F A PDI  KF QFA
Sbjct  1    MKFFAVLALCIVGAIASPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFA 60
Query  60   GKDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQ 119
            GKDL ++K TG FATHA RIV F+SE++AL GN++N  A+ +L+  +  +HKARG+  AQ
Sbjct  61   GKDLASIKDTGAFATHATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQ 120
Query  120  FNEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            F EFR +LV+YLQ+ VSW D++ AAW + LDN F ++   L
Sbjct  121  FGEFRTALVAYLQANVSWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 6. Allergen Name: Chi t 5 Sequence ID: P02224

 Score = 148.0 bits 618,  Expect = 1e-37
 Identities = 88/160 55%, Positives = 123/160 76%, Gaps = 0/160 0%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MKFLVLALCIAAA AA L+ ++A LV+ +W+ VK +EVDILY +FKA PDIMAKFPQFAG
Sbjct  1    MKFLVLALCIAAASAAVLTTEQADLVKKTWSTVKFNEVDILYAVFKAYPDIMAKFPQFAG 60
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDL+++K +  FATHA RIV F+SE+++L G+ AN+PA++ L K++A +HK RG+ K QF
Sbjct  61   KDLDSIKDSAAFATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQF 120
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
             EFR +L +YL++ ++++     AWT  LD  + M+FS +
Sbjct  121  TEFRTALFTYLKAHINFDGPTETAWTLALDTTYAMLFSAM 160

Sequence Alignment: 7. Allergen Name: Chi t 8 Sequence ID: P02227

 Score = 143.0 bits 596,  Expect = 3e-36
 Identities = 83/144 57%, Positives = 110/144 76%, Gaps = 0/144 0%
Query  17   PLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAGKDLETLKGTGQFATHA 76
            P+SAD+ +L + SW  VKH+EVDILY +FKANPDI AKFPQFAGKDL+++K +  FA H+
Sbjct  4    PMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHS 63
Query  77   GRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLVSYLQSKVS 136
            GRIVGF SE++ L+GN  N PA++TLI  +A++HKARGI KAQF EFRASLV YL   + 
Sbjct  64   GRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLD 123
Query  137  WNDSLGAAWTQGLDNVFNMMFSYL 160
            WND++ + W   L+N+F  ++  L
Sbjct  124  WNDTMKSTWDLALNNMFFYILHAL 147

Sequence Alignment: 8. Allergen Name: Chi t 2.0101 Sequence ID: P02221

 Score = 129.8 bits 538,  Expect = 4e-32
 Identities = 78/154 50%, Positives = 110/154 71%, Gaps = 2/154 1%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MKFL+LALC+AAA+A P S D+ +  + SW  VK+++VDILY +FKANPDI   F QFAG
Sbjct  1    MKFLILALCVAAAMAGP-SGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFAG 59
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDL+++KGT  F+ HAGR+VG+ SE++ L+GN AN P +    KD   +HK+R  P AQ+
Sbjct  60   KDLDSIKGTPDFSKHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSRASP-AQL 118
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMM 156
            + FR SLV YL+    W+ ++ ++W   LD VF+ +
Sbjct  119  DNFRKSLVVYLKGATKWDSAVESSWAPVLDFVFSTL 154

Sequence Alignment: 9. Allergen Name: Chi t 2.0102 Sequence ID: AAA80190

 Score = 129.3 bits 536,  Expect = 5e-32
 Identities = 78/154 50%, Positives = 110/154 71%, Gaps = 2/154 1%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MKFL+LALC+AAA+A P S D+ +  + SW  VK+++VDILY +FKANPDI   F QFAG
Sbjct  1    MKFLILALCVAAAMAGP-SGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFAG 59
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDL+++KGT  F+ HAGR+VG+ SE++ L+GN AN P +    KD   +HK+R  P AQ+
Sbjct  60   KDLDSIKGTPDFSKHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSRTSP-AQL 118
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMM 156
            + FR SLV YL+    W+ ++ ++W   LD VF+ +
Sbjct  119  DNFRKSLVVYLKGATKWDSAVESSWAPVLDFVFSTL 154

Sequence Alignment: 10. Allergen Name: Chi t 9 Sequence ID: P02228

 Score = 123.2 bits 509,  Expect = 3e-30
 Identities = 71/143 49%, Positives = 94/143 65%, Gaps = 0/143 0%
Query  18   LSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAGKDLETLKGTGQFATHAG 77
            L A E   V+ +W  V H EV+ILY +FKA+PDIMAKFP+FAGKDLE +K T  FA HA 
Sbjct  7    LDAHEVEQVQATWKAVSHDEVEILYTVFKAHPDIMAKFPKFAGKDLEAIKDTADFAVHAS 66
Query  78   RIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLVSYLQSKVSW 137
            RI+GF  E V L+G+S N  A+ TL+ D+   HK RGI KAQF EFR ++ +YL+    W
Sbjct  67   RIIGFFGEYVTLLGSSGNQAAIRTLLHDLGVFHKTRGITKAQFGEFRETMTAYLKGHNKW 126
Query  138  NDSLGAAWTQGLDNVFNMMFSYL 160
            N  +  +W   +D  F+++F  L
Sbjct  127  NADISHSWDDAFDKAFSVIFEVL 149

Sequence Alignment: 11. Allergen Name: Chi t 1.01 Sequence ID: P02229

 Score = 116.6 bits 480,  Expect = 3e-28
 Identities = 79/151 52%, Positives = 104/151 68%, Gaps = 9/151 5%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MKFL+LALC AAA A  LSAD+ S V+ S+ +VK   V ILY +FKA+P IMAKF QFAG
Sbjct  1    MKFLILALCFAAASA--LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAG 58
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDLE++KGT  F  HA RIVGF S+I+        +P +E  +    A+HK RG+   Q+
Sbjct  59   KDLESIKGTAPFEIHANRIVGFFSKIIG------ELPNIEADVNTFVASHKPRGVTHDQL 112
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            N FRA +VSY+++   +  +  AAW   LD  F M+FS +
Sbjct  113  NNFRAGFVSYMKAHTDFAGAE-AAWGATLDTFFGMIFSKM 151

Sequence Alignment: 12. Allergen Name: Chi t 1.0201 Sequence ID: P02230

 Score = 107.7 bits 441,  Expect = 2e-25
 Identities = 71/151 47%, Positives = 104/151 68%, Gaps = 9/151 5%
Query  1    MKFLVLALCIAAAVAAPLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAG 60
            MK+L+LALC AAA A  L+AD+ S V+ S+A VK   V ILY +FKA+P I AKF QFAG
Sbjct  1    MKLLILALCFAAASA--LTADQISTVQSSFAGVKGDAVGILYAVFKADPSIQAKFTQFAG 58
Query  61   KDLETLKGTGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQF 120
            KDL+++KG+  F+ HA +IVGF S+I+       ++P ++  +    A+H  RG+   Q+
Sbjct  59   KDLDSIKGSADFSAHANKIVGFFSKIIG------DLPNIDGDVTTFVASHTPRGVTHDQL 112
Query  121  NEFRASLVSYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
            N FRA +VSY+++   +  +  AAW   LD  F M+F+ +
Sbjct  113  NNFRAGFVSYMKAHTDFAGAE-AAWGATLDAFFGMVFAKM 151

Sequence Alignment: 13. Allergen Name: Chi t 4 Sequence ID: P02231

 Score = 71.0 bits 280,  Expect = 2e-14
 Identities = 49/142 34%, Positives = 84/142 59%, Gaps = 10/142 7%
Query  12   AAVAAPLSAD-EASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFA--GKDLETLKG 68
            A  A P   D + + V+G W ++K S V+ILY+ +   P     FP F   G DL   KG
Sbjct  2    ATPAMPSMTDAQVAAVKGDWEKIKGSGVEILYFFLNKFP---GNFPMFKKLGNDLAAAKG 58
Query  69   TGQFATHAGRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLV 128
            T +F  +A +I+ F+  ++  +G+  +M   + L+  +  +HKA GI K QF++FR +L 
Sbjct  59   TAEFKDQADKIIAFLQGVIEKLGS--DMGGAKALLNQLGTSHKAMGITKDQFDQFRQALT 116
Query  129  SYLQSKVSWNDSLGAAWTQGLDNVFNMMFSYL 160
              L   + +  ++GA W   +D +F+++F+ L
Sbjct  117  ELL-GNLGFGGNIGA-WNATVDLMFHVIFNAL 146

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.