The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE
KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB48041 Alt a 6 113 703 154.5 6.5e-40
P42037 Alt a 6 113 688 151.3 5.7e-39
AAL79930 Fus c 1 109 570 126.6 1.5e-31
P42039 Cla h 10.0101 111 542 120.7 9.2e-30
P42039 Cla h 5.0101 111 526 117.4 9.4e-29
CAA55067 Cla h 5.0101 111 526 117.4 9.4e-29
Q9UUZ6 Asp f 8 111 482 108.2 5.6e-26
Q8H2B9 Pru du 5.0101 113 413 93.7 1.3e-21
P50344 Cla h 12 110 213 51.8 5.2e-09
AEX34122 Pen cr 26.0101 107 202 49.5 2.5e-08
AAX11194 Pen b 26.0101 107 198 48.7 4.5e-08
P49148 Alt a 12 110 173 43.4 1.7e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Alt a 6 Sequence ID: AAB48041

 Score = 154.5 bits 703,  Expect = 6e-40
 Identities = 113/113 100%, Positives = 113/113 100%, Gaps = 0/113 0%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 2. Allergen Name: Alt a 6 Sequence ID: P42037

 Score = 151.3 bits 688,  Expect = 6e-39
 Identities = 111/113 98%, Positives = 112/113 99%, Gaps = 0/113 0%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASG E
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGSE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            KLASVPSGGAGGAAASGGAAAAGGSA+AEAAPEAAKEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGAAASGGAAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 3. Allergen Name: Fus c 1 Sequence ID: AAL79930

 Score = 126.6 bits 570,  Expect = 2e-31
 Identities = 96/109 88%, Positives = 100/109 91%, Gaps = 4/109 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVL SVGI+AD DRL+KLISELEGKDI +LIA G E
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            KLASVPSGGAGGA  SGGAAAAGG+AE   A E  KEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGA--SGGAAAAGGAAE--EAKEEEKEEEKEESDEDMGFGLFD 109

Sequence Alignment: 4. Allergen Name: Cla h 10.0101 Sequence ID: P42039

 Score = 120.7 bits 542,  Expect = 9e-30
 Identities = 85/111 76%, Positives = 99/111 89%, Gaps = 2/111 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MK++AAYLLLGL GN+SPSA D+K VL SVGI+AD +RL  L+ ELEGKDINELI+SG +
Sbjct  1    MKYMAAYLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSQ 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            KLASVPSGG+G A ++GGAAAAGG+ E  AAPEAAKEEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGSGAAPSAGGAAAAGGATE--AAPEAAKEEEKEESDDDMGFGLFD 111

Sequence Alignment: 5. Allergen Name: Cla h 5.0101 Sequence ID: P42039

 Score = 117.4 bits 526,  Expect = 9e-29
 Identities = 87/110 79%, Positives = 100/110 90%, Gaps = 4/110 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MK+LAA+LLLGL GN+SPSA D+K VL SVGI+AD +RL  L+ ELEGKDINELI+SG E
Sbjct  1    MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAK-EEEKEESDEDMGFGLFD 113
            KLASVPSGGAG AA++GGAAAAGG+AE  AAPEA + EEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGAG-AASAGGAAAAGGAAE--AAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 6. Allergen Name: Cla h 5.0101 Sequence ID: CAA55067

 Score = 117.4 bits 526,  Expect = 9e-29
 Identities = 87/110 79%, Positives = 100/110 90%, Gaps = 4/110 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MK+LAA+LLLGL GN+SPSA D+K VL SVGI+AD +RL  L+ ELEGKDINELI+SG E
Sbjct  1    MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAK-EEEKEESDEDMGFGLFD 113
            KLASVPSGGAG AA++GGAAAAGG+AE  AAPEA + EEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGAG-AASAGGAAAAGGAAE--AAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 7. Allergen Name: Asp f 8 Sequence ID: Q9UUZ6

 Score = 108.2 bits 482,  Expect = 6e-26
 Identities = 82/111 73%, Positives = 92/111 82%, Gaps = 2/111 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MK+LAA+LLL L GNTSPS+ DVKAVL SVGI+AD +RL+KLI+ELEGKD+ ELIA G  
Sbjct  1    MKYLAAFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAELEGKDLQELIAEGST 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            KLASVPSGGA  AA +   AAAGG+A A AA E   EEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAAAAAPAAAGAAAGGAA-APAAKEK-NEEEKEESDEDMGFGLFD 111

Sequence Alignment: 8. Allergen Name: Pru du 5.0101 Sequence ID: Q8H2B9

 Score = 93.7 bits 413,  Expect = 1e-21
 Identities = 71/112 63%, Positives = 85/112 75%, Gaps = 2/112 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
            MK +AAYLL  LGGNT+PSA D+K +L SVG E D DR+  L+SE++GKDI ELIASG E
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIASGRE 60
Query  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAA-KEEEKEESDEDMGFGLFD 113
            KLASVPSGG   A A+ GA A G +A A A P+   K EEKE++D+DMGF LFD
Sbjct  61   KLASVPSGGGAVAVAAPGAGA-GAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD 113

Sequence Alignment: 9. Allergen Name: Cla h 12 Sequence ID: P50344

 Score = 51.8 bits 213,  Expect = 5e-09
 Identities = 47/80 58%, Positives = 58/80 72%, Gaps = 25/80 31%
Query  26   VLESVGIEADSDRLDKLISE-----------------LEGKDINELIASGPEKLASVPSG 68
            +L   G+E  +D+L  LIS                  LEGKD+ +L       L +V SG
Sbjct  14   ILADEGLEITADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSG 66
Query  69   GAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            G G A A+GGAAA G +A  +A  E   EEEKEESD+DMGFGLFD
Sbjct  67   G-GAAPAAGGAAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110

Sequence Alignment: 10. Allergen Name: Pen cr 26.0101 Sequence ID: AEX34122

 Score = 49.5 bits 202,  Expect = 2e-08
 Identities = 40/87 45%, Positives = 55/87 63%, Gaps = 8/87 9%
Query  26   VLESVGIEADSDRLDKLISELEGKDINELIAS-------GPEKLASVPSGGAGGAAASGG 78
            +L   GIE  +D++  LIS    +++  + AS       G +    + + G+ G A++  
Sbjct  14   ILADDGIEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGSAGPASAAP 73
Query  79   AAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            A AAG +A AE   E  KEEEKEESDEDMGFGLFD
Sbjct  74   AGAAGAAAPAEEKAEE-KEEEKEESDEDMGFGLFD 107

Sequence Alignment: 11. Allergen Name: Pen b 26.0101 Sequence ID: AAX11194

 Score = 48.7 bits 198,  Expect = 4e-08
 Identities = 47/96 48%, Positives = 60/96 62%, Gaps = 13/96 13%
Query  6    AYLLLGLGGNTSPSAADVKAVLESVGI-EADSDRLDKLISELEGKDINELIASGPEKLAS 64
            A L+L   G    SA  ++ +L +  + E +      +   LEGKDI E+       L +
Sbjct  11   AALILADDG-IEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEI-------LTN 62
Query  65   VPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            V   G+ G A +G  AAAG +A AE   E  KEEEKEESDEDMGFGLFD
Sbjct  63   V---GSAGPATAGAPAAAGAAAPAEEKKEE-KEEEKEESDEDMGFGLFD 107

Sequence Alignment: 12. Allergen Name: Alt a 12 Sequence ID: P49148

 Score = 43.4 bits 173,  Expect = 2e-06
 Identities = 43/99 43%, Positives = 59/99 59%, Gaps = 10/99 10%
Query  6    AYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISE-LEGKDINELIASGPEKLAS 64
            A L+L   G    +A  +++++++  IE        L ++ LEGKD+ +L       L +
Sbjct  11   AALILADDG-VDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDL-------LLN 62
Query  65   VPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113
            V SGG G A           +A+A  A E  KEEEKEESDEDMGFGLFD
Sbjct  63   VGSGG-GAAPLPEALLLRWRAADAAPAAEEKKEEEKEESDEDMGFGLFD 110

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.