The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE
KLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAL79930 Fus c 1 109 679 151.3 5.6e-39
P42037 Alt a 6 113 576 129.4 2.2e-32
AAB48041 Alt a 6 113 570 128.2 5.2e-32
CAA55067 Cla h 5.0101 111 532 120.1 1.4e-29
P42039 Cla h 5.0101 111 532 120.1 1.4e-29
Q9UUZ6 Asp f 8 111 524 118.4 4.4e-29
P42039 Cla h 10.0101 111 523 118.2 5.1e-29
Q8H2B9 Pru du 5.0101 113 413 94.9 5.3e-22
AAX11194 Pen b 26.0101 107 221 54.3 8.7e-10
AEX34122 Pen cr 26.0101 107 215 53.0 2.1e-09
P50344 Cla h 12 110 212 52.4 3.4e-09
P49148 Alt a 12 110 170 43.5 1.6e-06
AAK00899 Cul n 1 78 128 34.7 0.00051
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fus c 1 Sequence ID: AAL79930

 Score = 151.3 bits 679,  Expect = 6e-39
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
Query  61   KLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109

Sequence Alignment: 2. Allergen Name: Alt a 6 Sequence ID: P42037

 Score = 129.4 bits 576,  Expect = 2e-32
 Identities = 97/109 88%, Positives = 101/109 92%, Gaps = 4/109 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVL SVGI+AD DRL+KLISELEGKDI +LIA GSE
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGSE 60
Query  61   KLASVPSGGAGGA--SGGAAAAGGAA--EEAKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGGAGGA  SGGAAAAGG+A  E A E  KEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGAAASGGAAAAGGSAQAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 3. Allergen Name: Alt a 6 Sequence ID: AAB48041

 Score = 128.2 bits 570,  Expect = 5e-32
 Identities = 96/109 88%, Positives = 100/109 91%, Gaps = 4/109 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MKHLAAYLLLGLGGNTSPSAADVKAVL SVGI+AD DRL+KLISELEGKDI +LIA G E
Sbjct  1    MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGPE 60
Query  61   KLASVPSGGAGGA--SGGAAAAGGAAEE--AKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGGAGGA  SGGAAAAGG+AE   A E  KEEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAGGAAASGGAAAAGGSAEAEAAPEAAKEEEKEESDEDMGFGLFD 113

Sequence Alignment: 4. Allergen Name: Cla h 5.0101 Sequence ID: CAA55067

 Score = 120.1 bits 532,  Expect = 1e-29
 Identities = 86/109 78%, Positives = 98/109 89%, Gaps = 2/109 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MK+LAA+LLLGL GN+SPSA D+K VL+SVGIDADE+RL+ L+ ELEGKDI +LI+ GSE
Sbjct  1    MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE 60
Query  61   KLASVPSGGAGGAS-GGAAAAGGAAEEAKEEEK-EEEKEESDEDMGFGLFD 109
            KLASVPSGGAG AS GGAAAAGGAAE A E E+ EEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGAGAASAGGAAAAGGAAEAAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 5. Allergen Name: Cla h 5.0101 Sequence ID: P42039

 Score = 120.1 bits 532,  Expect = 1e-29
 Identities = 86/109 78%, Positives = 98/109 89%, Gaps = 2/109 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MK+LAA+LLLGL GN+SPSA D+K VL+SVGIDADE+RL+ L+ ELEGKDI +LI+ GSE
Sbjct  1    MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE 60
Query  61   KLASVPSGGAGGAS-GGAAAAGGAAEEAKEEEK-EEEKEESDEDMGFGLFD 109
            KLASVPSGGAG AS GGAAAAGGAAE A E E+ EEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGAGAASAGGAAAAGGAAEAAPEAERAEEEKEESDDDMGFGLFD 111

Sequence Alignment: 6. Allergen Name: Asp f 8 Sequence ID: Q9UUZ6

 Score = 118.4 bits 524,  Expect = 4e-29
 Identities = 86/109 78%, Positives = 97/109 88%, Gaps = 2/109 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MK+LAA+LLL L GNTSPS+ DVKAVL+SVGIDADE+RLNKLI+ELEGKD+Q+LIAEGS 
Sbjct  1    MKYLAAFLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAELEGKDLQELIAEGST 60
Query  61   KLASVPSGGAGGASGGAA--AAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGGA  A+  AA  AAGGAA  A +E+ EEEKEESDEDMGFGLFD
Sbjct  61   KLASVPSGGAAAAAPAAAGAAAGGAAAPAAKEKNEEEKEESDEDMGFGLFD 111

Sequence Alignment: 7. Allergen Name: Cla h 10.0101 Sequence ID: P42039

 Score = 118.2 bits 523,  Expect = 5e-29
 Identities = 82/109 75%, Positives = 96/109 88%, Gaps = 2/109 1%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MK++AAYLLLGL GN+SPSA D+K VL+SVGIDADE+RL+ L+ ELEGKDI +LI+ GS+
Sbjct  1    MKYMAAYLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSQ 60
Query  61   KLASVPSGGAGGA--SGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGG+G A  +GGAAAAGGA E A E  KEEEKEESD+DMGFGLFD
Sbjct  61   KLASVPSGGSGAAPSAGGAAAAGGATEAAPEAAKEEEKEESDDDMGFGLFD 111

Sequence Alignment: 8. Allergen Name: Pru du 5.0101 Sequence ID: Q8H2B9

 Score = 94.9 bits 413,  Expect = 5e-22
 Identities = 71/109 65%, Positives = 86/109 78%, Gaps = 4/109 3%
Query  1    MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGKDIQQLIAEGSE 60
            MK +AAYLL  LGGNT+PSA D+K +L SVG + D+DR+  L+SE++GKDI +LIA G E
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIASGRE 60
Query  61   KLASVPSGG---AGGASG-GAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
            KLASVPSGG   A  A G GA AA  AA E K+EEK EEKE++D+DMGF LFD
Sbjct  61   KLASVPSGGGAVAVAAPGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD 113

Sequence Alignment: 9. Allergen Name: Pen b 26.0101 Sequence ID: AAX11194

 Score = 54.3 bits 221,  Expect = 9e-10
 Identities = 49/94 52%, Positives = 64/94 68%, Gaps = 13/94 13%
Query  6    AYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISE-LEGKDIQQLIAEGSEKLAS 64
            A L+L   G    SA  ++ +L +  +   E     + ++ LEGKDI+++       L +
Sbjct  11   AALILADDG-IEVSADKIQTILGAAKVQEVEPIWATIFAKALEGKDIKEI-------LTN 62
Query  65   VPSGGAGGASGGAAAAGGAAE--EAKEEEKEEEKEESDEDMGFGLFD 109
            V  G AG A+ GA AA GAA   E K+EEKEEEKEESDEDMGFGLFD
Sbjct  63   V--GSAGPATAGAPAAAGAAAPAEEKKEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 10. Allergen Name: Pen cr 26.0101 Sequence ID: AEX34122

 Score = 53.0 bits 215,  Expect = 2e-09
 Identities = 47/95 49%, Positives = 61/95 64%, Gaps = 11/95 11%
Query  6    AYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISE-LEGKDIQQLIAE-GSEKLA 63
            A L+L   G    SA  ++ ++++  +   E     + +  LEGKDI++L+   GS    
Sbjct  11   AALILADDG-IEISADKIQTLISAANVQEVEPIWASIFARALEGKDIKELLTNVGS---- 65
Query  64   SVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
               +G A  A  GAA A   AEE K EEKEEEKEESDEDMGFGLFD
Sbjct  66   ---AGPASAAPAGAAGAAAPAEE-KAEEKEEEKEESDEDMGFGLFD 107

Sequence Alignment: 11. Allergen Name: Cla h 12 Sequence ID: P50344

 Score = 52.4 bits 212,  Expect = 3e-09
 Identities = 43/84 51%, Positives = 59/84 70%, Gaps = 11/84 13%
Query  19   SAADVKAVLTSVGIDADEDRLNKLISE-LEGKDIQQLIAEGSEKLASVPSGGAGGASGGA 77
            +A  ++A++++  +   E     L ++ LEGKD++ L       L +V SGG    + G 
Sbjct  23   TADKLQALISAAKVPEIEPIWTSLFAKALEGKDVKDL-------LLNVGSGGGAAPAAGG 75
Query  78   AAAGGAAE--EAKEEEK-EEEKEESDEDMGFGLFD 109
            AAAGGAA   +A  EEK EEEKEESD+DMGFGLFD
Sbjct  76   AAAGGAAAVLDAPAEEKAEEEKEESDDDMGFGLFD 110

Sequence Alignment: 12. Allergen Name: Alt a 12 Sequence ID: P49148

 Score = 43.5 bits 170,  Expect = 2e-06
 Identities = 45/94 47%, Positives = 58/94 61%, Gaps = 16/94 17%
Query  15   NTSPSAADVKA-VLTSVGIDADEDRLNKLISELEGKDIQQ----LIA---EGSE-KLASV 65
            +TS  A    A +L   G+D   D+L  LI   + ++++     L A   EG + K   +
Sbjct  2    STSELATSYAALILADDGVDITADKLQSLIKAAKIEEVEPIWTTLFAKALEGKDVKDLLL 61
Query  66   PSGGAGGASGGAAA------AGGAAEEAKEEEKEEEKEESDEDMGFGLFD 109
              G  GGA+    A      A  AA  A EE+KEEEKEESDEDMGFGLFD
Sbjct  62   NVGSGGGAAPLPEALLLRWRAADAAP-AAEEKKEEEKEESDEDMGFGLFD 110

Sequence Alignment: 13. Allergen Name: Cul n 1 Sequence ID: AAK00899

 Score = 34.7 bits 128,  Expect = 0.0005
 Identities = 26/58 44%, Positives = 35/58 60%, Gaps = 1/58 1%
Query  50   DIQQLIAEGSEKLASVPSGGAGGASGGAAAAGGAAEEAKEEEKEEEKEESDEDMGFGLF 108
            D+    AE  ++    PS  A  A+  A AA    EE K+EEK+EE EESD+D+G+ LF
Sbjct  20   DVDSKEAETIKEYIKDPSKIAAAAAATAPAAETKKEE-KKEEKKEETEESDDDIGLSLF 77

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.