The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ
LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF
VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sequence Info Allergen Name Length Opt Bits Score E Value
O61379 Pan s 1 274 1660 385.0 1.6e-108
AAC48288 Hom a 1.0102 284 1643 381.1 2.4e-107
M1H607 Por p 1.0101 284 1636 379.5 7.2e-107
C0LU07 Pro c 1.0101 284 1628 377.7 2.6e-106
Q25456 Met e 1 274 1626 377.2 3.3e-106
AAX37288 Pen m 1 284 1625 377.0 4.1e-106
EU410072 Lit v 1.0101 284 1625 377.0 4.1e-106
11893851 Pen a 1 284 1625 377.0 4.1e-106
D3XNR9 Mac r 1.0101 284 1617 375.2 1.5e-105
CBY17558 Pan b 1.0101 284 1591 369.3 8.8e-104
M4M2H6 Mel l 1.0101 284 1580 366.7 5e-103
O44119 Hom a 1.0101 284 1557 361.5 1.9e-101
A7L5V2 Scy p 1.0101 284 1547 359.2 9.2e-101
Q9N2R3 Cha f 1 264 1413 328.7 1.3e-91
AEX31649 Cho a 10.0101 284 1399 325.5 1.3e-90
BAA04557 Der f 10.0101 299 1395 324.6 2.6e-90
AAF72534 Bla g 7.0101 284 1388 323.0 7.5e-90
AAD19606 Per a 7.0102 284 1386 322.5 1e-89
Q9NFZ4 Lep d 10 284 1386 322.5 1e-89
NP_001103782 Bomb m 3.0101 285 1386 322.5 1e-89
ABU97466 Blo t 10.0101 284 1384 322.1 1.4e-89
Q9UB83 Per a 7 284 1382 321.6 1.9e-89
O18416 Der p 10 284 1375 320.0 5.9e-89
AAT40866 Tyr p 10.0101 284 1359 316.4 7.3e-88
Q17H75 Aed a 10.0101 285 1353 315.0 1.9e-87
CAA09938 Chi k 10 285 1307 304.5 2.7e-84
Q9NAS5 Ani s 3 284 1239 289.0 1.3e-79
ACN32322 Asc l 3.0101 287 1236 288.3 2e-79
AGM32377.1 Copt f 7.0101 256 1226 286.1 8.6e-79
CAC84590 Lep s 1 284 1146 267.8 3e-73
CAB38044 Hel as 1 284 1104 258.2 2.3e-70
Q17H80 Aed a 10.0201 284 1096 256.4 8.2e-70
APG42675 Hal l 1.0101 284 1084 253.7 5.4e-69
AAG08987 Hal d 1 284 1067 249.8 8e-68
AVD53650 Sac g 1.0101 284 1039 243.4 6.7e-66
AAG08989 Mim n 1 284 972 228.2 2.6e-61
NP_001117128 Sal s 4.0101 284 950 223.1 8.5e-60
AAG08988 Per v 1 284 948 222.7 1.2e-59
XP_026775428 Pan h 4.0201 284 948 222.7 1.2e-59
AAK96889 Cra g 1 233 941 221.2 2.7e-59
XP_026781482 Pan h 4.0101 284 878 206.7 7.4e-55
AAO73464 Der p 11 875 203 52.7 5.5e-08
AAK39511 Der f 11.0101 692 197 51.3 1.1e-07
QPB41107 Rap v 2.0101 859 197 51.3 1.4e-07
AAM83103 Blo t 11 875 186 48.8 8e-07
AAF72796 Ani s 2 869 180 47.4 2.1e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 385.0 bits 1660,  Expect = 2e-108
 Identities = 274/274 100%, Positives = 274/274 100%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 2. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 381.1 bits 1643,  Expect = 2e-107
 Identities = 271/274 98%, Positives = 272/274 99%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEANIRAEK+EEEVHNLQKRMQQLENDLDQVQESLLKANTQ
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 3. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 379.5 bits 1636,  Expect = 7e-107
 Identities = 270/274 98%, Positives = 271/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKD+AMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ
Sbjct  11   MKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKS TDELDQ FSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 4. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 377.7 bits 1628,  Expect = 3e-106
 Identities = 268/273 98%, Positives = 271/273 99%, Gaps = 0/273 0%
Query  2    KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQL 61
            KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQ+LENDLDQVQESLLKANTQL
Sbjct  12   KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQVQESLLKANTQL 71
Query  62   EEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE 121
            EEKDKA+SNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE
Sbjct  72   EEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLE 131
Query  122  NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKFV 181
            NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK V
Sbjct  132  NRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKIV 191
Query  182  ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQK 241
            ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQK
Sbjct  192  ELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQK 251
Query  242  EVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            EVDRLEDELVNEKEKYKSITDELDQTFSEL+GY
Sbjct  252  EVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 5. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 377.2 bits 1626,  Expect = 3e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  1    MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQ 60
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  61   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 6. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 377.0 bits 1625,  Expect = 4e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 7. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 377.0 bits 1625,  Expect = 4e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 8. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 377.0 bits 1625,  Expect = 4e-106
 Identities = 269/274 98%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLDQVQESLLKAN Q
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANIQ 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 375.2 bits 1617,  Expect = 1e-105
 Identities = 267/274 97%, Positives = 270/274 98%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEVHNLQKRMQQLENDLD VQE+LLKAN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSVQEALLKANQH 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 10. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 369.3 bits 1591,  Expect = 9e-104
 Identities = 263/274 95%, Positives = 268/274 97%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN RAEK+EEEV  LQK++QQLENDLD VQE+LLKAN +
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSVQEALLKANQH 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 11. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 366.7 bits 1580,  Expect = 5e-103
 Identities = 261/274 95%, Positives = 268/274 97%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEANIRAEKAE++V+ LQK++QQLEND+DQVQE+LL ANT 
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANTN 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
              EKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   AVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 12. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 361.5 bits 1557,  Expect = 2e-101
 Identities = 257/274 93%, Positives = 264/274 96%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEANIRAEK EEE+   +K+MQQ+EN+LDQVQE L  ANT+
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQVQEQLSLANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 359.2 bits 1547,  Expect = 9e-101
 Identities = 253/274 92%, Positives = 262/274 95%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN+RAEK EEE+   QK+MQQ+EN+LDQ QE L  ANT+
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EK+KAL NAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY
Sbjct  251  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 328.7 bits 1413,  Expect = 1e-91
 Identities = 232/254 91%, Positives = 241/254 94%, Gaps = 0/254 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRADTLEQQNKEAN+RAEK EEE+   QK+MQQ+EN+LDQ QE L  ANT+
Sbjct  11   MKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLSAANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EK+KAL NAEGEVAALNRRIQL EEDLERSEERLNTATTKLAEASQAADESERMRKVL
Sbjct  71   LDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAADESERMRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YKEQIKTL NKLKAAEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEK 254
            KEVDRLEDELVNEK
Sbjct  251  KEVDRLEDELVNEK 264

Sequence Alignment: 15. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 325.5 bits 1399,  Expect = 1e-90
 Identities = 222/274 81%, Positives = 256/274 93%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA+  EQ++++AN++AEK+EEEV  LQK++QQ+EN+LDQVQES+ +ANT+
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESFTQANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS+AADESERMRK+L
Sbjct  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 16. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 324.6 bits 1395,  Expect = 3e-90
 Identities = 223/274 81%, Positives = 253/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA+  EQ+ ++AN+RAEK+EEEV  LQK++QQ+EN+LDQVQE L  ANT+
Sbjct  26   MKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQVQEQLSAANTK 85
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+ADESERMRK+L
Sbjct  86   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKML 145
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERMD LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  146  EHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 205
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  206  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQ 265
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  266  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 17. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 323.0 bits 1388,  Expect = 8e-90
 Identities = 225/273 82%, Positives = 246/273 90%, Gaps = 0/273 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRA   EQQ ++ANIRAEKAEEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTL  +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSG 273
            KEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  251  KEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 18. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 224/273 82%, Positives = 247/273 90%, Gaps = 0/273 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMDRA   EQQ ++AN+RAEKAEEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSG 273
            KEVDRLEDELV+EKEKYK I D+LD TF+EL G
Sbjct  251  KEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 19. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 220/274 80%, Positives = 256/274 93%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA+  EQ++++AN+RAEK+EEEV  LQK++QQ+EN+LDQVQESL +ANT+
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQVQESLTQANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+K+L  AEG+VAALNRRIQL+EEDLERSE RL  AT+KL EASQ+ADESERMRK+L
Sbjct  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERM+ LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  EHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 20. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 322.5 bits 1386,  Expect = 1e-89
 Identities = 227/271 83%, Positives = 244/271 90%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA   EQQ K+AN+RAEKAEEE   LQK++Q +EN+LDQ QESL++ N +
Sbjct  11   MKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLMQVNGK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL TAT KL+EASQAADESER RKVL
Sbjct  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEASQAADESERARKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV EKEKYK I D+LD  F EL
Sbjct  251  KEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 21. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 322.1 bits 1384,  Expect = 1e-89
 Identities = 219/274 79%, Positives = 256/274 93%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA+  EQ++++AN+RAEK+EEEV  LQK++QQ+EN+LDQVQESL +ANT+
Sbjct  11   MKLEKDNAIDRAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQVQESLTQANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+K+L  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EAS++ADESERMRK+L
Sbjct  71   LEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERMD LE+QLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGE+K 
Sbjct  131  EHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGETKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T KLK AEARAEFAERSV+KLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAEFAERSVRKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 22. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 321.6 bits 1382,  Expect = 2e-89
 Identities = 223/274 81%, Positives = 247/274 90%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMD A   EQQ ++AN+RAEKAEEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNAMDCALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQA DESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAVDESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKYK I D+LD TF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 23. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 320.0 bits 1375,  Expect = 6e-89
 Identities = 220/274 80%, Positives = 252/274 91%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA+  EQ+ ++AN+RAEK+EEEV  LQK++QQ+EN+LDQVQE L  ANT+
Sbjct  11   MKLEKDNAIDRAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQVQEQLSAANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL  AEG+VAALNRRIQL+EEDLERSEERL  AT KL EASQ+ADESERMRK+L
Sbjct  71   LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERM+ LENQLKEAR +AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  EHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEA+++QI+ +T KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEV RLEDELV+EKEKYKSI+DELDQTF+EL+GY
Sbjct  251  KEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 316.4 bits 1359,  Expect = 7e-88
 Identities = 215/274 78%, Positives = 254/274 92%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLE+DNA+DRA+  EQ+ ++AN+++EK EEEV  LQK++QQ+EN+LDQVQE+L +A T+
Sbjct  11   MKLEEDNAIDRAEIAEQKARDANLKSEKTEEEVRALQKKIQQIENELDQVQENLTQATTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL  AE +VAALNRRIQL+EEDLERSEERL  AT KL EAS++ADESERMRK+L
Sbjct  71   LEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESERMRKML 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RS++DEERMD LE+QLKEAR++AE+ADRKYDEVARKLAMVEADLERAEERAETGESK 
Sbjct  131  EHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADLERAEERAETGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QREEAY++QI+ +T+KLK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKEKY+SI+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 315.0 bits 1353,  Expect = 2e-87
 Identities = 220/271 81%, Positives = 240/271 88%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA   EQQ ++AN+RAEKAEEE   LQK++Q +ENDLDQ QE+L+  N +
Sbjct  11   MKLEKDNALDRALLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQTQEALMAVNAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+KAL NAE EVAALNRRIQLLEEDLERSEERL +AT KL+EAS AADESER RKVL
Sbjct  71   LEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAADESERARKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENR+L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE GE K 
Sbjct  131  ENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAEAGEGKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV EKEKY+ I D+LD  F EL
Sbjct  251  KEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 26. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 304.5 bits 1307,  Expect = 3e-84
 Identities = 215/271 79%, Positives = 235/271 86%, Gaps = 0/271 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA+DRA   E Q ++AN+RAEKAEEE   LQK++Q +ENDLDQ Q      N +
Sbjct  11   MKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQTQGQETLVNGK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE K+KAL NAE EVAALNRRIQLL EDL+RSEERL +AT KL+EAS AADESER RK+L
Sbjct  71   LEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRSL+DEERMDALENQLKEARFLAEEAD+KYDEVARKLAMVEADLERAEERAE GE+K 
Sbjct  131  ENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKANQREE YK QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSEL 271
            KEVDRLEDELV+EKEKY+ I D+LD  F EL
Sbjct  251  KEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 27. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 289.0 bits 1239,  Expect = 1e-79
 Identities = 197/274 71%, Positives = 236/274 86%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSTANSN 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEATHTADESERVRKVM 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKL MVEADLERAEERAETGE+K 
Sbjct  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADLERAEERAETGENKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 28. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 288.3 bits 1236,  Expect = 2e-79
 Identities = 197/274 71%, Positives = 236/274 86%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EKDNA+DRAD  E++ ++   + E+ EEE+ + QK+M Q ENDLD+ QE L  AN+ 
Sbjct  11   MKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTENDLDKAQEDLSVANSN 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+K +  AE EVAALNRR+ LLEE+LER+EERL  AT KL EA++ ADESER+RKV+
Sbjct  71   LEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEATHTADESERVRKVM 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRS+ DEER + +E+QLKEA+ LAEEADRKYDEVARKLAMVEADLERAEERAE GE+K 
Sbjct  131  ENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKA QRE++Y+EQI+T++ +LK AE RAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAETRAEFAERSVQKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDELV+EKE+YKSI++ELDQTF ELSGY
Sbjct  251  KEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 29. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 286.1 bits 1226,  Expect = 9e-79
 Identities = 198/241 82%, Positives = 218/241 90%, Gaps = 0/241 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDN MDRA   EQQ ++AN+RAEKAEEE  +LQK++QQ+ENDLDQ  E L++ N +
Sbjct  11   MKLEKDNTMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLMQVNAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            L+EKDKAL NAE EVAALNRRIQLLEEDLERSEERL TAT KLAEASQAADESER RK+L
Sbjct  71   LDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERARKIL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E++ L+DEERMDALENQLKEARF+AEEAD+KYDEVARKLAMVEADLERAEERAE+GESK 
Sbjct  131  ESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAESGESKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            VELEEELRVVGNNLKSLEVSEEKAN REE YK+QIKTLT +LK AEARAEFAERSVQKLQ
Sbjct  191  VELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAERSVQKLQ 250
Query  241  K 241
            K
Sbjct  251  K 251

Sequence Alignment: 30. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 267.8 bits 1146,  Expect = 3e-73
 Identities = 184/274 67%, Positives = 228/274 83%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNAMD+AD LE Q ++AN +A+K  EEV++L+K+  Q+E D+   +E+L  AN  
Sbjct  11   MKLEKDNAMDKADALEAQARDANRKADKILEEVQDLKKKPSQVETDFTTTKENLATANKN 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE+K+K L+N E EVA+LNR++Q++EE+LERSEERL TA TKL EAS+AADE+ RM KVL
Sbjct  71   LEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEASHAADEASRMCKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRS  DEERMD L NQLKEAR LAE+AD K DEV+RK+A VE DLE AE+R ++G+SK 
Sbjct  131  ENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAEDRVKSGDSKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGN+LKSLEVSEEKANQR E YK QIKTLT KLK AEARAE+AE+ V+KLQ
Sbjct  191  MELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAEARAEYAEKYVKKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL   K++Y+++ DE+DQTF+ELSGY
Sbjct  251  KEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 258.2 bits 1104,  Expect = 2e-70
 Identities = 173/274 63%, Positives = 223/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EK+NA+DRA+ +EQ+ ++      K EE+++NLQK+   LEND+D + E LL ANT+
Sbjct  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K  +  E E A L RRIQLLEEDLERSEERL +AT KL EAS+AADESER RKVL
Sbjct  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEASKAADESERGRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RK+DE ARKLA+ E DLERAE R E  E+K 
Sbjct  131  ESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRASEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+ +DELD TF+EL+GY
Sbjct  251  KEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 32. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 256.4 bits 1096,  Expect = 8e-70
 Identities = 177/274 64%, Positives = 222/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MKLEKDNA D+ADT E Q KEAN+RA+K  EEV  L KR+ Q+  D ++ + +L +AN  
Sbjct  11   MKLEKDNAADKADTCENQAKEANLRADKIMEEVAELTKRLTQVTEDHEKFKNTLEQANKD 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LEEK+K L++ E  VAAL R++Q +EEDLE+SEER   A +KL EA+Q+ADE+ RM KVL
Sbjct  71   LEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSADENNRMCKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENRS  DEERMD L NQLKEAR LAE+AD K DEV+RKLA VE +LE AE+R ++GE+K 
Sbjct  131  ENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKSGEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGN+LKSLEVSE+KANQR E +K Q+K+LT KLK AE RAE AE++V+KLQ
Sbjct  191  MELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAENAEKNVKKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLED+L+NEK+KYK+I D+LD TF+EL+GY
Sbjct  251  KEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 33. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 253.7 bits 1084,  Expect = 5e-69
 Identities = 172/274 62%, Positives = 224/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V E L +A T+
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AADESER RKVL
Sbjct  71   LETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADESERGRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE R E  E+K 
Sbjct  131  ESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 34. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 249.8 bits 1067,  Expect = 8e-68
 Identities = 169/274 61%, Positives = 222/274 81%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EK+NA+DRA+  EQ+ ++   +  K EE+++NLQK+   LEND+D V E L +A  +
Sbjct  11   MKMEKENAVDRAEQNEQKLRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNEQLQEAMAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K ++  E EV+   R+I LLEEDLER+EERL TAT +L EAS+AADESER  +VL
Sbjct  71   LETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADESERGARVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E+RSL+D+ER+D LE QLKEA+++AE+A+RKYDE ARKLA+ E DLERAE R E  E+K 
Sbjct  131  ESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLEAAEAKI 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 35. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 243.4 bits 1039,  Expect = 7e-66
 Identities = 166/274 60%, Positives = 213/274 77%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EK+NA DRA+ LEQQ ++   +  K EE++  LQK+   LEN++D V E       +
Sbjct  11   MKMEKENAQDRAEQLEQQLRDTEEQKAKIEEDLTTLQKKHSNLENEFDIVNEKYQDCQAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             EE +K  S +E E+ +LNRRIQLLEED+ERSEERL TAT KL EAS+AADESER RKVL
Sbjct  71   YEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            EN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DLERAE R E  E+K 
Sbjct  131  ENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAEARLEAAEAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            ++LEE+L VVGNN+K+L+V  ++A+QRE++Y+E I+ LT +LK AE RA  AER+V KLQ
Sbjct  191  IDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  251  KEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 36. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 228.2 bits 972,  Expect = 3e-61
 Identities = 156/274 56%, Positives = 206/274 75%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK++++NA D A+ +EQ+ K+      K EEE + LQK++   EN+ D V E L +ANT+
Sbjct  11   MKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQEANTK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K ++  E +V  L RR+ LLEED ERSEE+LN+ T KL EAS+AADESER RKVL
Sbjct  71   LENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            E RS S EER+D LE QL+ A+ +A +AD K+DE ARKLA+ E DLERAE R E  ++K 
Sbjct  131  EGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            +ELEEEL VVG N+K+L+V  ++A+QRE++Y+E I+ LT  LK AE RA  AER V KLQ
Sbjct  191  LELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKE+YK+I+D+LDQTF+E++GY
Sbjct  251  KEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 223.1 bits 950,  Expect = 9e-60
 Identities = 152/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            +KL+K+NA+DRA+  E   K A  ++++ E+++  LQK+++  E++LD+  ESL  A  +
Sbjct  11   LKLDKENALDRAEGAEGDKKAAEDKSKQLEDDLVALQKKLKGTEDELDKYSESLKDAQEK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA TKL EA +AADESER  KV+
Sbjct  71   LEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENR+  DEE+M+  + QLKEA+ +AEEADRKY+EVARKL ++E+DLER EERAE  E K 
Sbjct  131  ENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKC 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             ELEEEL+ V NNLKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAERSV KL+
Sbjct  191  SELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL  +K KYK+I++ELD  +++++
Sbjct  251  KTIDDLEDELYAQKLKYKAISEELDNALNDMT 282

Sequence Alignment: 38. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 222.7 bits 948,  Expect = 1e-59
 Identities = 151/274 55%, Positives = 204/274 74%, Gaps = 0/274 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            MK+EK NA+DRA+ LEQ+ +E      K E++ ++L K+  Q END D     L     +
Sbjct  11   MKMEKKNALDRAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTENDYDNCNTQLQDVQAK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             E  +K +   E E+ +L R+I LLEE + ++EER+ TA+ KL EAS+AADESER RKVL
Sbjct  71   YERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEASKAADESERNRKVL 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            EN +  ++ER+D LE QL EA+++AEEAD+KY+E ARKLA+ E DLERAE R E  E+K 
Sbjct  131  ENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDLERAEARLEAAEAKV 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
            ++LEE+L VVG N+K+L+V  ++A+QRE++Y+E I+ LTN+LK AE RA  AER+V KLQ
Sbjct  191  IDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQ 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
            KEVDRLEDEL+ EKEKYK+I+DELD TF+EL+GY
Sbjct  251  KEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 39. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 222.7 bits 948,  Expect = 1e-59
 Identities = 151/272 55%, Positives = 211/272 77%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            +KL+K+NA+DRA+  E   K A  R+++ E+++  LQK+++  E++LD+  E+L  A  +
Sbjct  11   LKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKYSEALKDAQEK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K  ++AE +VA+LNRRIQL+EE+L+R++ERL TA  KL EA +AADESER  KV+
Sbjct  71   LELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENR+L DEE+M+  E QLKEA+ +AEEADRKY+EVARKL +VE +LER EERAE  E K 
Sbjct  131  ENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSEGKC 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             ELEEEL+ V N LKSLE   EK +Q+E+ Y+E+IK LT+KLK AE RAEFAER+V KL+
Sbjct  191  AELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL ++K KYK+I++ELD+ +++++
Sbjct  251  KTIDDLEDELYSQKLKYKAISEELDHALNDMT 282

Sequence Alignment: 40. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 151/228 66%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  47   LDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 106
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
Query  107  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 166
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
Query  167  ERAEERAETGESKFVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 226
            ERAE R E  E+K +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
Query  227  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 206.7 bits 878,  Expect = 7e-55
 Identities = 142/272 52%, Positives = 201/272 73%, Gaps = 0/272 0%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            +K +K+NA DRA+  E   K +  + ++ E+E+  LQK+++  E+++D+  E+L  A  +
Sbjct  11   LKGDKENAFDRAEQAELDKKVSEDKCKQLEDELLGLQKKLKGTEDEVDKYSEALKDAQEK 70
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
            LE  +K  ++AEGEVAALNRRIQL+EE+L+R++ RL TA  KL EA + ADESER  KV+
Sbjct  71   LELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAEKQADESERGMKVI 130
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
            ENR++ DEE+M+  E QLKEA+ +AE++DRKYDEVARKL ++E +LERAEERAE  E K 
Sbjct  131  ENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELERAEERAEVSELKS 190
Query  181  VELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQ 240
             +LEEEL+ V N LKSLE   EK + +E+ Y+E+I  L  KLK AE RAEFAE++V KL+
Sbjct  191  GDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAETRAEFAEKTVSKLE 250
Query  241  KEVDRLEDELVNEKEKYKSITDELDQTFSELS 272
            K +D LEDEL N+K K K+I +ELD  +++++
Sbjct  251  KTIDDLEDELYNQKLKVKAICEELDNALNDMT 282

Sequence Alignment: 42. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 52.7 bits 203,  Expect = 5e-08
 Identities = 61/251 24%, Positives = 126/251 50%, Gaps = 8/251 3%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L   +  
Sbjct  218  VKLQLDNANHLKQQIAQQLEDTRHRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEA 277
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
              E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  278  RLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEEQLEAL 331
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
             N+  S E++   L+++++      E+A     ++ +++A +E      +++ E      
Sbjct  332  LNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQLEKINLDLKDKLEEVTMLM 391
Query  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
             + ++ELR+    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  392  EQAQKELRIKIGELQKLQHEYEKVRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 450
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  451  EIEIKRLENERDELSAAYK 469
 Score = 39.4 bits 145,  Expect = 0.0005
 Identities = 66/236 27%, Positives = 120/236 50%, Gaps = 36/236 15%
Query  12   ADTLEQQNKEANIR--AEKAEEEVHNLQKRMQQLENDLD----QVQESLLKANTQLEEKD 65
            A+TL +Q +  N R  AE A+   H+ +KR+ Q + +++    Q Q  + + N +L E +
Sbjct  471  AETLRKQEEAKNQRLIAELAQVR-HDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAE 529
Query  66   KALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSL 125
              L     E+A L ++ Q    +LE S +  N A   L +  +        ++ L+   L
Sbjct  530  AKLKT---EIARLKKKYQAQITELELSLDAANKANIDLQKTIK--------KQALQITEL 578
Query  126  SDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLER---AEERAETGESKFVE 182
              +   D +  QL++A       D +     R+   ++A+LE    A E+A   + +  +
Sbjct  579  --QAHYDEVHRQLQQA------VD-QLGVTQRRCQALQAELEEMRIALEQASRAKRQAEQ 629
Query  183  LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKE 242
            L EE  V  N L ++ V+   A  + E+   +   L             ++  VQKL  E
Sbjct  630  LHEEAVVRVNELTTINVNLASAKSKLES---EFSALQADYDEVHKELRISDERVQKLTIE 686
Query  243  VDRLEDELVNEKE---KYKSITDELDQTFSEL 271
            +   +D L+ E+E   K +++   L+Q    L
Sbjct  687  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTL 718

Sequence Alignment: 43. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 63/251 25%, Positives = 127/251 50%, Gaps = 8/251 3%
Query  1    MKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            +KL+ DNA      + QQ ++   R E+ E +  +L+   + LE +L+ ++  L + +  
Sbjct  132  VKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELESLKVQLDEESEA 191
Query  61   LEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
              E ++ L+ A G+ A+   +    E +L+   + +     K+A   Q   E E   + L
Sbjct  192  RLELERQLTKANGDAASWKSK---YEAELQAHADEVEELRRKMA---QKISEYEEQLEAL 245
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKF 180
             N+  S E++   L+++++      E+A R   ++ +++A +E      + + E      
Sbjct  246  LNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLM 305
Query  181  VELEEELRVVGNNLKSLEVSEEKA-NQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
             + ++ELRV    L+ L+   EK  +QR++  +E  K LT+ L  A+++   A R +++ 
Sbjct  306  EQAQKELRVKIAELQKLQHEYEKLRDQRDQLAREN-KKLTDDLAEAKSQLNDAHRRIHEQ 364
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  365  EIEIKRLENERDELSAAYK 383

Sequence Alignment: 44. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 76/262 29%, Positives = 140/262 53%, Gaps = 48/262 18%
Query  4    EKDNAMDRADT-LEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQLE 62
            E+++ + R +  L  Q +EAN+  + A  E+ +L++   QLE + D +  +L      L 
Sbjct  413  ERNDNLQRENKHLSDQLREANLALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALR 472
Query  63   EKDKALSNAEGEVAALN----RRIQLLEEDLE---RSEER-LNTATTKLAEA-SQAADES 113
            + +  L++A+  +  L      R++  +E++E   RS  R +      L E  ++   E 
Sbjct  473  DAEAKLASAQAALNQLKIDMENRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEI 532
Query  114  ERMRKVLE-------------NRSLSD--------EERMDALENQLKEARFLAEE----- 147
             RM+K +E             NR+ S+        ++R+  LE  L+E R ++++     
Sbjct  533  SRMKKKFESDIRELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQL 592
Query  148  --ADRKYDEVARKLAMVEADLERAEERAETGESKFVELEEELRVVGNNLKSLEVSEEKAN 205
              A+RK   +A++L    A LE AE   +  E+++ +    L  +   + SL   + +  
Sbjct  593  GVAERKRVALAQELEDARALLEGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLE 652
Query  206  QREEAYKEQIKTLTNKLKAAEARAEFAERSVQKLQKEVDRLEDELVNEKEKYK---SITD 262
                A +  +    N  + AE RAE       +L  E  RL DEL  E+E YK   S+  
Sbjct  653  ADLSAMQSDLDDAINNQRGAEERAE-------RLAAENGRLADELRQEQENYKNAESLRK 705
Query  263  ELDQTFSELS 272
            +L+    E++
Sbjct  706  QLEVEIREIT 715

Sequence Alignment: 45. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 48.8 bits 186,  Expect = 8e-07
 Identities = 57/249 22%, Positives = 122/249 48%, Gaps = 10/249 4%
Query  2    KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQL 61
            K+  DNA      + QQ ++   R E  E +  +L+   + LE +L+ ++  L + +   
Sbjct  219  KISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEAR 278
Query  62   EEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
             E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +        L
Sbjct  279  LELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSAL 338
Query  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLE-RAEERAETGESK 179
            E +    +  ++ L   L++A   A+  +++  ++ +    +  DL+ + EE +   E  
Sbjct  339  EKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEVSMLLE-- 392
Query  180  FVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
              + +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A R +++ 
Sbjct  393  --QTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQ 450
Query  240  QKEVDRLEDELVNEKEKYK 258
            + E+ RLE+E       YK
Sbjct  451  EIEIKRLENEREELAAAYK 469

Sequence Alignment: 46. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 47.4 bits 180,  Expect = 2e-06
 Identities = 69/255 27%, Positives = 137/255 53%, Gaps = 23/255 9%
Query  2    KLEKDNAMDRADT-LEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQ 60
            ++E ++ +  A+T + Q   + +       EEV +L+K+M Q + + ++  E +L+  +Q
Sbjct  280  RVEAEHKLSLANTEITQWKSKFDAEVALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQ 339
Query  61   LEEKDKALSNAEGEVAALN-RRIQLLEEDLERSEERLNTATTKLAEASQAADESERMRKV 119
            LE K KA   +E EV  ++  + Q     LER++E+L           Q  +   R+ ++
Sbjct  340  LE-KAKARLQSEVEVLIVDLEKAQNTIAILERAKEQLE---------KQVLEMKSRIDEL 389
Query  120  LENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESK 179
            L     +  E   AL  +L++ + L E+A  + + +AR+   ++ DL  A E       K
Sbjct  390  LVELEAAQREARAALA-ELQKMKQLYEKAVEQKEALARENKKLQDDLHEANEALADANRK 448
Query  180  FVELE-EELRVVGNNLKSLEVS--EEKANQRE-EAYKEQIKTLTNKLKAA-EARAEFAER 234
            + EL+ E  R+ G  ++ L+V+  E +A +R+ EA  ++      +++   E R +  E 
Sbjct  449  LHELDLENARLAGE-IRDLQVALKESEAARRDAEARAQRALAELQQVRIEMERRLQEKEE 507
Query  235  SVQKLQK----EVDRLEDELVNEKEKYKSITDELDQTF 268
             ++ L+K    E+DRL   L + + + K+    L + +
Sbjct  508  EMEALRKSMQFEIDRLTAALADAEARMKAEIARLRKKY 545

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.