The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI
LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK
EGVRDLKELPSKCGLSELECGSRGNRYFV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q2PS07 Fag e 2.0101 149 1021 156.1 3.6e-40
ADW27428 Fag t 2.0101 149 864 133.8 1.9e-33
BAB79444 Fag e 8kD 133 466 77.2 1.8e-16
P01089 Ric c 1 258 210 41.3 2.3e-05
DQ631675 Pis v 1.0101 149 196 39.0 6.8e-05
ACO56333 Cor a 14.0101 147 182 37.0 0.00027
AAK15088 Ses i 1 153 180 36.7 0.00033
AAB41308 Jug r 1 139 170 35.2 0.00085
AAA33010 Ber e 1 146 169 35.1 0.00096
P04403 Ber e 1 146 169 35.1 0.00096
AAD56337 Ara h 6 129 164 34.3 0.0015
CAA38363 Ber e 1 154 159 33.7 0.0026
AAK96887 Ara h 2.0101 156 157 33.4 0.0032
AAM54365 Jug n 1 161 156 33.3 0.0036
Q39649 Cuc ma 5.0101 141 155 33.1 0.0037
AAD42943 Ses i 2 148 154 33.0 0.0042
ACN62248 Ara h 2.0101 157 154 33.0 0.0044
Q8LPD3 Lin u 1.01 168 154 33.1 0.0045
Q8LPD3 Lin u 1.01 168 154 33.1 0.0045
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fag e 2.0101 Sequence ID: Q2PS07

 Score = 156.1 bits 1021,  Expect = 4e-40
 Identities = 149/149 100%, Positives = 149/149 100%, Gaps = 0/149 0%
Query  1    MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
            MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI
Sbjct  1    MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
            LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK
Sbjct  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
Query  121  EGVRDLKELPSKCGLSELECGSRGNRYFV 149
            EGVRDLKELPSKCGLSELECGSRGNRYFV
Sbjct  121  EGVRDLKELPSKCGLSELECGSRGNRYFV 149

Sequence Alignment: 2. Allergen Name: Fag t 2.0101 Sequence ID: ADW27428

 Score = 133.8 bits 864,  Expect = 2e-33
 Identities = 123/149 82%, Positives = 137/149 91%, Gaps = 0/149 0%
Query  1    MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
            MKLFIILATATLLIAATQA Y RDEGFDLGETQMSSKC RQVKM EP L KCNRYIAMDI
Sbjct  1    MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDI 60
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
            +DDKY EALSR++GEGC+SEE  +RGCCVAMKEM+DECVCEWMKMMVENQKGRIGE L++
Sbjct  61   MDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMR 120
Query  121  EGVRDLKELPSKCGLSELECGSRGNRYFV 149
            +G+RDLKELP+KCG+SE+EC SRGN Y+V
Sbjct  121  KGIRDLKELPNKCGISEMECHSRGNWYYV 149

Sequence Alignment: 3. Allergen Name: Fag e 8kD Sequence ID: BAB79444

 Score = 77.2 bits 466,  Expect = 2e-16
 Identities = 70/123 56%, Positives = 100/123 81%, Gaps = 17/123 13%
Query  1    MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
            MKLF+ILA A+LLI A++A           ++QM SKC +Q++M EP+L++C  Y+ MD+
Sbjct  1    MKLFLILAAASLLIVASHA-----------DSQMRSKCRKQMRMMEPQLEQCEGYMTMDM 49
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
            +DD        + G  C+SEESCMRGCC+AMKEMDDEC+CEWMKMMV+ Q+G +GE  ++
Sbjct  50   MDD------DSMRGRECRSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMR 103
Query  121  EGVRDLKELPSKCGLSELEC 140
              +R +K+LP+KCG+  + C
Sbjct  104  MVMRKMKQLPNKCGMGHMRC 123

Sequence Alignment: 4. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 41.3 bits 210,  Expect = 2e-05
 Identities = 35/103 33%, Positives = 58/103 56%, Gaps = 7/103 6%
Query  37   KCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSR-VEGEGCK---SEESCMRGCCVAMK 92
            +CMRQ + N P  + C   I       +  E + + V G+G +   ++E  +RGCC  +K
Sbjct  148  RCMRQTRTN-PSQQGCRGQIQEQQNLRQCQEYIKQQVSGQGPRRSDNQERSLRGCCDHLK 206
Query  93   EMDDECVCEWMKMMVENQK--GRIGERLIKEGVRDLKELPSKCGLSELEC 140
            +M  +C CE ++  +E Q+  G++  + + E  R    LPS CG+S  EC
Sbjct  207  QMQSQCRCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGVSPTEC 256
 Score = 38.0 bits 187,  Expect = 0.0002
 Identities = 40/130 30%, Positives = 69/130 53%, Gaps = 7/130 5%
Query  3    LFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILD 62
            L+ I+A A++    T  T   DE     E   S +C ++V+  +  L  C RY+      
Sbjct  14   LLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKD--LSSCERYLRQSSSR 71
Query  63   DKYAEALSRVEGEGCKSEESC-MRGCCVAMKEMDDECVCEWMKMMVENQ--KGRI-GERL 118
                E + R+ G+  + +ES  ++ CC  +K++ DEC CE +K + E+Q  +G++ GE  
Sbjct  72   RSPGEEVLRMPGDENQQQESQQLQQCCNQVKQVRDECQCEAIKYIAEDQIQQGQLHGEES 131
Query  119  IKEGVRDLKELPSKCGL 135
             +   R   E+ S CG+
Sbjct  132  ERVAQRA-GEIVSSCGV 147

Sequence Alignment: 5. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 39.0 bits 196,  Expect = 7e-05
 Identities = 38/128 29%, Positives = 70/128 54%, Gaps = 12/128 9%
Query  2    KLFIILATATLLIAATQATYPRDEGFDLGETQMSSK-CMRQVKMNEPHLKKCNRYIAMDI 60
            KL ++L+   +LI A  A+  R      GE   S + C +Q +  +  +K C  Y+  ++
Sbjct  3    KLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFE-EQQKFKHCQMYVQQEV 61
Query  61   LDDKYAEALS-RVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMV--ENQKGRI-GE 116
               +   +L+ R+        + C + CC  ++E+D +C C+ ++ MV  + Q+G+  GE
Sbjct  62   QKSQDGHSLTARIN-----QRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGE 116
Query  117  RLIKEGVRDLKELPSKCGLS 136
            +L +E      ELP  C +S
Sbjct  117  KL-QELYETASELPRMCNIS 135

Sequence Alignment: 6. Allergen Name: Cor a 14.0101 Sequence ID: ACO56333

 Score = 37.0 bits 182,  Expect = 0.0003
 Identities = 35/132 26%, Positives = 66/132 50%, Gaps = 15/132 11%
Query  7    LATATLLIAATQATYPRDEGFDLGETQMSSK------CMRQVKMNEPHLKKCNRYIAMDI 60
            L  A LL+A   A        D+ E  ++ +      C  Q +  + +L +C RY+    
Sbjct  10   LFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQ-RQQNLNQCQRYMRQQS 68
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
                Y       +G   + ++  +  CC  +++MD+ C CE ++  V  Q+G +    ++
Sbjct  69   QYGSY-------DGSN-QQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMR 120
Query  121  EGVRDLKELPSKCGLSELECGSRGNRY 147
            E +   ++LP++C LS   C  R  R+
Sbjct  121  EVMETARDLPNQCRLSPQRCEIRSARF 147

Sequence Alignment: 7. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 36.7 bits 180,  Expect = 0.0003
 Identities = 32/137 23%, Positives = 62/137 45%, Gaps = 4/137 2%
Query  5    IILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDK 64
            +++A   L  A T  T       D    Q S +C +Q++  +  ++ C RY++       
Sbjct  11   LLVAMVALASATTYTTTVTTTAIDDEANQQSQQCRQQLQGRQ--FRSCQRYLSQGRSPYG 68
Query  65   YAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMV--ENQKGRIGERLIKEG 122
              E        G +  E  +R CC  ++ +D+ C CE ++  V  + Q+G   E   ++ 
Sbjct  69   GEEDEVLEMSTGNQQSEQSLRDCCQQLRNVDERCRCEAIRQAVRQQQQEGGYQEGQSQQV 128
Query  123  VRDLKELPSKCGLSELECGSR 143
             +  ++LP +C +   +C  R
Sbjct  129  YQRARDLPRRCNMRPQQCQFR 149

Sequence Alignment: 8. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 35.2 bits 170,  Expect = 0.0008
 Identities = 38/126 30%, Positives = 64/126 50%, Gaps = 17/126 13%
Query  3    LFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILD 62
            LF+  A A      T  T   DE  D    +    C  Q++  + +L  C  Y+      
Sbjct  8    LFVANAAA---FRTTITTMEIDEDID-NPRRRGEGCREQIQ-RQQNLNHCQYYLRQQ--- 59
Query  63   DKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGER--LIK 120
                   SR  G    ++    R CC  + +MD++C CE ++ +V  Q+ + G R   ++
Sbjct  60   -------SRSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEME 112
Query  121  EGVRDLKELPSKCGLSELECGSR 143
            E V+  ++LP++CG+S   C  R
Sbjct  113  EMVQSARDLPNECGISSQRCEIR 135

Sequence Alignment: 9. Allergen Name: Ber e 1 Sequence ID: AAA33010

 Score = 35.1 bits 169,  Expect = 0.001
 Identities = 38/134 28%, Positives = 71/134 52%, Gaps = 16/134 11%
Query  2    KLFIILATATLLIAATQATYPRDE-GFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
            K+ +  A   +L+A  +AT  R      + E +   +C  Q++  +  L  C  Y+   +
Sbjct  3    KISVAAAALLVLMALGHATAFRATVTTTVVEEENQEECREQMQ-RQQMLSHCRMYMRQQM 61
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMV-----ENQKGRIG 115
             +  Y + + R      +  E  M  CC  ++ MD+ C CE ++MM+     E  + R G
Sbjct  62   EESPY-QTMPR------RGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPR-G 113
Query  116  ERLIKEGVRDLKELPSKCGLSELECGSRGN 145
            E++ +  +R  + +PS+C LS + C   G+
Sbjct  114  EQM-RRMMRLAENIPSRCNLSPMRCPMGGS 142

Sequence Alignment: 10. Allergen Name: Ber e 1 Sequence ID: P04403

 Score = 35.1 bits 169,  Expect = 0.001
 Identities = 38/134 28%, Positives = 71/134 52%, Gaps = 16/134 11%
Query  2    KLFIILATATLLIAATQATYPRDE-GFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
            K+ +  A   +L+A  +AT  R      + E +   +C  Q++  +  L  C  Y+   +
Sbjct  3    KISVAAAALLVLMALGHATAFRATVTTTVVEEENQEECREQMQ-RQQMLSHCRMYMRQQM 61
Query  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMV-----ENQKGRIG 115
             +  Y + + R      +  E  M  CC  ++ MD+ C CE ++MM+     E  + R G
Sbjct  62   EESPY-QTMPR------RGMEPHMSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPR-G 113
Query  116  ERLIKEGVRDLKELPSKCGLSELECGSRGN 145
            E++ +  +R  + +PS+C LS + C   G+
Sbjct  114  EQM-RRMMRLAENIPSRCNLSPMRCPMGGS 142

Sequence Alignment: 11. Allergen Name: Ara h 6 Sequence ID: AAD56337

 Score = 34.3 bits 164,  Expect = 0.001
 Identities = 31/101 30%, Positives = 56/101 55%, Gaps = 8/101 7%
Query  30   GETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCV 89
            G    SS C RQV  +  +LK C ++I   I+ ++  E          +S +   R CC 
Sbjct  11   GRQGDSSSCERQV--DGVNLKPCEQHIMQRIMGEQ--EQYDSYNFGSTRSSDQQQR-CCD 65
Query  90   AMKEMDD--ECVCEWMKMMVENQKGRIGER-LIKEGVRDLKELPSKCGL 135
             + EM++   C+CE ++ ++ENQ   + +R +++   R+L  LP +C +
Sbjct  66   ELNEMENTQRCMCEALQQIMENQCDGLQDRQMVQHFKRELMNLPQQCNF 114

Sequence Alignment: 12. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 33.7 bits 159,  Expect = 0.003
 Identities = 35/121 28%, Positives = 61/121 50%, Gaps = 18/121 14%
Query  9    TATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEA 68
            T T  +   Q   PR      G ++   +C  Q++  + +L  C  Y+   + +  Y   
Sbjct  26   TVTTTLEEEQEENPR------GRSE--QQCREQME-RQQQLNHCRMYLRQQMEESPYQNP 76
Query  69   LSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRI---GERLIKEGVRD 125
                 GE     E  +  CC  ++ MD+ C CE ++MM+  Q+  +   GE++ +  +R 
Sbjct  77   RPLRRGE-----EPHLDECCEQLERMDEMCRCEGLRMMLRRQREEMELQGEQM-QRIMRK 130
Query  126  LKELPSKCGLSELECGSRG 144
             + L S+C LS   C   G
Sbjct  131  AENLLSRCNLSPQRCPMGG 149

Sequence Alignment: 13. Allergen Name: Ara h 2.0101 Sequence ID: AAK96887

 Score = 33.4 bits 157,  Expect = 0.003
 Identities = 40/125 32%, Positives = 74/125 59%, Gaps = 24/125 19%
Query  2    KLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDIL 61
            KL I++A A +L+AA  +   R +     E Q   +C  Q ++   +L+ C +++   I 
Sbjct  3    KLTILVALALFLLAAHASA--RQQ----WELQGDRRC--QSQLERANLRPCEQHLMQKIQ 54
Query  62   DDK-------YAEAL-----SRVEGEGCKSEESCMRGCCVAMKEMDDE--CVCEWMKMMV 107
             D+       Y+ +      S  +  G  S +   R CC  + E ++   C+CE ++ ++
Sbjct  55   RDEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQER-CCNELNEFENNQRCMCEALQQIM 113
Query  108  ENQKGRI-GERLIKEGVRDLKELPSKCGL 135
            ENQ  R+ G +  ++  R+L+ LP +CGL
Sbjct  114  ENQSDRLQGRQQEQQFKRELRNLPQQCGL 142

Sequence Alignment: 14. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 33.3 bits 156,  Expect = 0.004
 Identities = 36/126 28%, Positives = 62/126 49%, Gaps = 17/126 13%
Query  3    LFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILD 62
            LF+  A A      T  T   DE  D    +    C  Q++  + +L  C  Y+      
Sbjct  30   LFVANAAA---FRTTITTMEIDEDID-NPRRRGEGCQEQIQ-RQQNLNHCQYYLRQQ--- 81
Query  63   DKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGER--LIK 120
                   SR  G    ++    R CC  + +++++C CE ++  V  Q+ + G R   ++
Sbjct  82   -------SRSGGYDEDNQRQHFRQCCQQLSQIEEQCQCEGLRQAVRRQQQQQGLRGEEME 134
Query  121  EGVRDLKELPSKCGLSELECGSR 143
            E V+  ++LP +CG+S   C  R
Sbjct  135  EMVQSARDLPKECGISSQRCEIR 157

Sequence Alignment: 15. Allergen Name: Cuc ma 5.0101 Sequence ID: Q39649

 Score = 33.1 bits 155,  Expect = 0.004
 Identities = 39/123 31%, Positives = 67/123 54%, Gaps = 22/123 17%
Query  5    IILATATLLIAATQATYPRDEGFDLGETQMSS--KCMRQVKMNEPHLKKCNRYI---AMD 59
            I L    LL+A   A        ++ E +     +C RQ+   E  L+ C +Y+   + D
Sbjct  8    IALFAVALLVADAYAYRTTITTVEVEENRQGREERC-RQMSARE-ELRSCEQYLRQQSRD 65
Query  60   ILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMV-ENQK---GRIG 115
            +L  +  E   R EG G   E      CC  +K +D+EC C+ ++ +  E Q+   G+ G
Sbjct  66   VLQMRGIENPWRREG-GSFDE------CCRELKNVDEECRCDMLEEIAREEQRQARGQEG 118
Query  116  ERLIKEGVRDLKELPSKCGLSELEC 140
             +++++     + LPS CG+    C
Sbjct  119  RQMLQKA----RNLPSMCGIRPQRC 139

Sequence Alignment: 16. Allergen Name: Ses i 2 Sequence ID: AAD42943

 Score = 33.0 bits 154,  Expect = 0.004
 Identities = 31/136 22%, Positives = 68/136 50%, Gaps = 7/136 5%
Query  3    LFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILD 62
            ++ +L  A L+ A+ + T       + GE +    C  + +  +  ++ C ++  M  + 
Sbjct  7    VLAVLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQ--MRHCMQW--MRSMR 62
Query  63   DKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIG-ERLIKE 121
             +Y E++ R   E  + +    R CC  ++++   C CE ++ M+   +   G E+ +++
Sbjct  63   GQYEESFLR-SAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQQ 121
Query  122  GVRDLKELPSKCGLS-ELECGSR 143
              + ++ LP  CG+S   EC  R
Sbjct  122  MQQMMQYLPRMCGMSYPTECRMR 144

Sequence Alignment: 17. Allergen Name: Ara h 2.0101 Sequence ID: ACN62248

 Score = 33.0 bits 154,  Expect = 0.004
 Identities = 44/135 32%, Positives = 80/135 59%, Gaps = 32/135 23%
Query  3    LFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDIL- 61
            L I++A A +L+AA  +   R +     E Q   +C  Q ++   +L+ C +++   I  
Sbjct  1    LTILVALALFLLAAHASA--RQQ----WELQGDRRC--QSQLERANLRPCEQHLMQKIQR 52
Query  62   -DDKYAE----------ALSRVEGEGCKSEESCMRGCCVAMKEMDDE--CVCEWMKMMVE 108
             +D Y            + S  +  G  S +   R CC  + E ++   C+CE ++ ++E
Sbjct  53   DEDSYERDPYSPSQDPYSPSPYDRRGAGSSQHQER-CCNELNEFENNQRCMCEALQQIME 111
Query  109  NQKGRI-GERLIKEGVRDLKELPSKCGLS-------ELECGSRGNRY 147
            NQ  R+ G +  ++  R+L+ LP +CGL        ++E G R +RY
Sbjct  112  NQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLDVESGGR-DRY 157

Sequence Alignment: 18. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 33.1 bits 154,  Expect = 0.005
 Identities = 30/140 21%, Positives = 67/140 47%, Gaps = 13/140 9%
Query  3    LFIILATATL-LIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDIL 61
            LF+I+  A++           +  G   G+ Q   +C +Q++  + +L+ C +++   + 
Sbjct  15   LFLIVVDASVRTTVIIDEDTNQGRGGQGGQGQQQ-QCEKQIQ-EQDYLRSCQQFLWEKV- 71
Query  62   DDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVEN------QKGRIG 115
              K   +    +G G   +      CC  +K++  EC C  ++  +        Q+G+  
Sbjct  72   -QKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECTCRGLERAIGQMRQDIQQQGQQQ 130
Query  116  E--RLIKEGVRDLKELPSKCGLSELECGSRGNR 146
            E  R +++  +  ++LP +CG     C  +G +
Sbjct  131  EVERWVQQAKQVARDLPGQCGTQPSRCQLQGQQ 163

Sequence Alignment: 19. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 33.1 bits 154,  Expect = 0.005
 Identities = 30/140 21%, Positives = 67/140 47%, Gaps = 13/140 9%
Query  3    LFIILATATL-LIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDIL 61
            LF+I+  A++           +  G   G+ Q   +C +Q++  + +L+ C +++   + 
Sbjct  15   LFLIVVDASVRTTVIIDEDTNQGRGGQGGQGQQQ-QCEKQIQ-EQDYLRSCQQFLWEKV- 71
Query  62   DDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVEN------QKGRIG 115
              K   +    +G G   +      CC  +K++  EC C  ++  +        Q+G+  
Sbjct  72   -QKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECTCRGLERAIGQMRQDIQQQGQQQ 130
Query  116  E--RLIKEGVRDLKELPSKCGLSELECGSRGNR 146
            E  R +++  +  ++LP +CG     C  +G +
Sbjct  131  EVERWVQQAKQVARDLPGQCGTQPSRCQLQGQQ 163

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.