The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLFLILAAASLLIVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC
RSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMRMVMRKMKQLPNKCGMGH
MRCHMGIGTRDYE
Sequence Info Allergen Name Length Opt Bits Score E Value
BAB79444 Fag e 8kD 133 956 148.0 8.3e-38
ADW27428 Fag t 2.0101 149 474 78.6 7.1e-17
Q2PS07 Fag e 2.0101 149 466 77.4 1.6e-16
CAA38363 Ber e 1 154 249 46.2 4.1e-07
ACO56333 Cor a 14.0101 147 242 45.2 7.8e-07
P04403 Ber e 1 146 234 44.1 1.7e-06
AAA33010 Ber e 1 146 234 44.1 1.7e-06
AAB41308 Jug r 1 139 215 41.3 1.1e-05
Q39649 Cuc ma 5.0101 141 211 40.8 1.6e-05
P01089 Ric c 1 258 203 39.5 7.1e-05
DQ631675 Pis v 1.0101 149 190 37.7 0.00014
AAK15088 Ses i 1 153 190 37.7 0.00015
AAM54365 Jug n 1 161 189 37.6 0.00017
AAO32314 Car i 1.0101 143 186 37.2 0.0002
AAL91665 Ana o 3 138 179 36.2 0.00039
AAD42943 Ses i 2 148 177 35.9 0.00052
AAD56337 Ara h 6 129 164 34.0 0.0016
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fag e 8kD Sequence ID: BAB79444

 Score = 148.0 bits 956,  Expect = 8e-38
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MKLFLILAAASLLIVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC 60
            MKLFLILAAASLLIVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC
Sbjct  1    MKLFLILAAASLLIVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC 60
Query  61   RSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMRMVMRKMKQLPNKCGMGH 120
            RSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMRMVMRKMKQLPNKCGMGH
Sbjct  61   RSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMRMVMRKMKQLPNKCGMGH 120
Query  121  MRCHMGIGTRDYE 133
            MRCHMGIGTRDYE
Sbjct  121  MRCHMGIGTRDYE 133

Sequence Alignment: 2. Allergen Name: Fag t 2.0101 Sequence ID: ADW27428

 Score = 78.6 bits 474,  Expect = 7e-17
 Identities = 73/124 58%, Positives = 99/124 79%, Gaps = 17/124 13%
Query  1    MKLFLILAAASLLIVASHA-----------DSQMRSKCRKQMRMMEPQLEQCEGYMTMDM 49
            MKLF+ILA A+LLI A++A           ++QM SKC +Q++MMEP+L +C  Y+ MD+
Sbjct  1    MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDI 60
Query  50   MDD------DSMRGRECRSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMR 103
            MDD        ++G  C SEE  +RGCC+AMKEM+DEC+CEWMKMMV+ Q+G +GE  MR
Sbjct  61   MDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMR 120
Query  104  MVMRKMKQLPNKCGMGHMRCH 124
              +R +K+LPNKCG+  M CH
Sbjct  121  KGIRDLKELPNKCGISEMECH 141

Sequence Alignment: 3. Allergen Name: Fag e 2.0101 Sequence ID: Q2PS07

 Score = 77.4 bits 466,  Expect = 2e-16
 Identities = 70/123 56%, Positives = 100/123 81%, Gaps = 17/123 13%
Query  1    MKLFLILAAASLLIVASHA-----------DSQMRSKCRKQMRMMEPQLEQCEGYMTMDM 49
            MKLF+ILA A+LLI A++A           ++QM SKC +Q++M EP+L++C  Y+ MD+
Sbjct  1    MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDI 60
Query  50   MDD------DSMRGRECRSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMGEEDMR 103
            +DD        + G  C+SEESCMRGCC+AMKEMDDEC+CEWMKMMV+ Q+G +GE  ++
Sbjct  61   LDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIK 120
Query  104  MVMRKMKQLPNKCGMGHMRC 123
              +R +K+LP+KCG+  + C
Sbjct  121  EGVRDLKELPSKCGLSELEC 140

Sequence Alignment: 4. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 46.2 bits 249,  Expect = 4e-07
 Identities = 38/99 38%, Positives = 60/99 60%, Gaps = 6/99 6%
Query  26   KCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECR-SEESCMRGCCLAMKEMDDECMCE 84
            +CR+QM   + QL +C  Y+   M +      R  R  EE  +  CC  ++ MD+ C CE
Sbjct  46   QCREQMERQQ-QLNHCRMYLRQQMEESPYQNPRPLRRGEEPHLDECCEQLERMDEMCRCE 104
Query  85   WMKMMVQQQRGEM---GEEDMRMVMRKMKQLPNKCGMGHMRCHMG 126
             ++MM+++QR EM   GE+ M+ +MRK + L ++C +   RC MG
Sbjct  105  GLRMMLRRQREEMELQGEQ-MQRIMRKAENLLSRCNLSPQRCPMG 148

Sequence Alignment: 5. Allergen Name: Cor a 14.0101 Sequence ID: ACO56333

 Score = 45.2 bits 242,  Expect = 8e-07
 Identities = 34/96 35%, Positives = 54/96 56%, Gaps = 3/96 3%
Query  27   CRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECRSEESCMRGCCLAMKEMDDECMCEWM 86
            CR+Q +  +  L QC+ YM        S  G   + ++  +  CC  +++MD+ C CE +
Sbjct  47   CREQAQRQQ-NLNQCQRYMRQQSQYG-SYDGSN-QQQQQELEQCCQQLRQMDERCRCEGL 103
Query  87   KMMVQQQRGEMGEEDMRMVMRKMKQLPNKCGMGHMRCHM 125
            +  V QQ+GEM  E+MR VM   + LPN+C +   RC +
Sbjct  104  RQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEI 142

Sequence Alignment: 6. Allergen Name: Ber e 1 Sequence ID: P04403

 Score = 44.1 bits 234,  Expect = 2e-06
 Identities = 36/111 32%, Positives = 63/111 56%, Gaps = 5/111 4%
Query  14   IVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECRSEESCMRGCCLA 73
            +  +  + + + +CR+QM+  +  L +C  YM   M ++   +    R  E  M  CC  
Sbjct  27   VTTTVVEEENQEECREQMQRQQ-MLSHCRMYMRQQM-EESPYQTMPRRGMEPHMSECCEQ 84
Query  74   MKEMDDECMCEWMKMMVQQ-QRGEMGE--EDMRMVMRKMKQLPNKCGMGHMRCHMG 126
            ++ MD+ C CE ++MM+ + Q+ EM    E MR +MR  + +P++C +  MRC MG
Sbjct  85   LEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMRLAENIPSRCNLSPMRCPMG 140

Sequence Alignment: 7. Allergen Name: Ber e 1 Sequence ID: AAA33010

 Score = 44.1 bits 234,  Expect = 2e-06
 Identities = 36/111 32%, Positives = 63/111 56%, Gaps = 5/111 4%
Query  14   IVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECRSEESCMRGCCLA 73
            +  +  + + + +CR+QM+  +  L +C  YM   M ++   +    R  E  M  CC  
Sbjct  27   VTTTVVEEENQEECREQMQRQQ-MLSHCRMYMRQQM-EESPYQTMPRRGMEPHMSECCEQ 84
Query  74   MKEMDDECMCEWMKMMVQQ-QRGEMGE--EDMRMVMRKMKQLPNKCGMGHMRCHMG 126
            ++ MD+ C CE ++MM+ + Q+ EM    E MR +MR  + +P++C +  MRC MG
Sbjct  85   LEGMDESCRCEGLRMMMMRMQQEEMQPRGEQMRRMMRLAENIPSRCNLSPMRCPMG 140

Sequence Alignment: 8. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 41.3 bits 215,  Expect = 1e-05
 Identities = 31/93 33%, Positives = 56/93 60%, Gaps = 9/93 9%
Query  27   CRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECRSEESCMRGCCLAMKEMDDECMCEWM 86
            CR+Q++  +  L +C+ Y+           G +  ++    R CC  + +MD++C CE +
Sbjct  39   CREQIQRQQ-NLNHCQYYLRQQSRSG----GYDEDNQRQHFRQCCQQLSQMDEQCQCEGL 93
Query  87   KMMV---QQQRGEMGEEDMRMVMRKMKQLPNKCGMGHMRCHM 125
            + +V   QQQ+G  GEE M  +++  + LPN+CG+   RC +
Sbjct  94   RQVVRRQQQQQGLRGEE-MEEMVQSARDLPNECGISSQRCEI 134

Sequence Alignment: 9. Allergen Name: Cuc ma 5.0101 Sequence ID: Q39649

 Score = 40.8 bits 211,  Expect = 2e-05
 Identities = 38/110 34%, Positives = 60/110 54%, Gaps = 7/110 6%
Query  11   SLLIVASHADSQMRS-KCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC--RSEESCM 67
            ++  V    + Q R  +CR QM   E +L  CE Y+     D   MRG E   R E    
Sbjct  26   TITTVEVEENRQGREERCR-QMSARE-ELRSCEQYLRQQSRDVLQMRGIENPWRREGGSF 83
Query  68   RGCCLAMKEMDDECMCEWMKMMV-QQQRGEMGEEDMRMVMRKMKQLPNKCGMGHMRC 123
              CC  +K +D+EC C+ ++ +  ++QR   G+E  R +++K + LP+ CG+   RC
Sbjct  84   DECCRELKNVDEECRCDMLEEIAREEQRQARGQEG-RQMLQKARNLPSMCGIRPQRC 139

Sequence Alignment: 10. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 39.5 bits 203,  Expect = 7e-05
 Identities = 30/92 32%, Positives = 54/92 58%, Gaps = 8/92 8%
Query  27   CRKQMRMMEPQLEQCEGYMTMDMMDDDSMRG-RECRSEESCMRGCCLAMKEMDDECMCEW 85
            CR Q++  +  L QC+ Y+   +    S +G R   ++E  +RGCC  +K+M  +C CE 
Sbjct  162  CRGQIQEQQ-NLRQCQEYIKQQV----SGQGPRRSDNQERSLRGCCDHLKQMQSQCRCEG 216
Query  86   MKMMVQQQR--GEMGEEDMRMVMRKMKQLPNKCGMGHMRC 123
            ++  ++QQ+  G++  +D+    R    LP+ CG+    C
Sbjct  217  LRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGVSPTEC 256

Sequence Alignment: 11. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 37.7 bits 190,  Expect = 0.0001
 Identities = 34/113 30%, Positives = 64/113 56%, Gaps = 11/113 9%
Query  4    FLILAA-ASLLIVASHADSQMRSK---CRKQMRMMEPQLEQCEGYMTMDMM---DDDSMR 56
            FLILAA AS+       + +  S    C+KQ    + ++++C+ Y+  ++    D  S+ 
Sbjct  13   FLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQ-KFKHCQMYVQQEVQKSQDGHSLT 71
Query  57   GRECRSEESCMRGCCLAMKEMDDECMCEWMKMMV--QQQRGEMGEEDMRMVMRKMKQLPN 114
             R     + C + CC  ++E+D +C C+ ++ MV  QQQ+G+   E ++ +     +LP 
Sbjct  72   AR-INQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQELYETASELPR 130
Query  115  KCGM 118
             C +
Sbjct  131  MCNI 134

Sequence Alignment: 12. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 37.7 bits 190,  Expect = 0.0001
 Identities = 31/104 29%, Positives = 61/104 58%, Gaps = 12/104 11%
Query  21   SQMRSKCRKQMRMMEPQLEQCEGYMTMDMM----DDDS---MRGRECRSEESCMRGCCLA 73
            +Q   +CR+Q++    Q+  C+ Y++        ++D    M     +SE+S +R CC  
Sbjct  38   NQQSQQCRQQLQGR--QFRSCQRYLSQGRSPYGGEEDEVLEMSTGNQQSEQS-LRDCCQQ 94
Query  74   MKEMDDECMCEWMKMMVQQQRGEMG--EEDMRMVMRKMKQLPNKCGMGHMRCHMGI 127
            ++ +D+ C CE ++  V+QQ+ E G  E   + V ++ + LP +C M   +C+  +
Sbjct  95   LRNVDERCRCEAIRQAVRQQQQEGGYQEGQSQQVYQRARDLPRRCNMRPQQCQFRV 150

Sequence Alignment: 13. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 37.6 bits 189,  Expect = 0.0002
 Identities = 27/93 29%, Positives = 54/93 58%, Gaps = 9/93 9%
Query  27   CRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRECRSEESCMRGCCLAMKEMDDECMCEWM 86
            C++Q++  +  L +C+ Y+           G +  ++    R CC  + +++++C CE +
Sbjct  61   CQEQIQRQQ-NLNHCQYYLRQQSRSG----GYDEDNQRQHFRQCCQQLSQIEEQCQCEGL 115
Query  87   KMMV---QQQRGEMGEEDMRMVMRKMKQLPNKCGMGHMRCHM 125
            +  V   QQQ+G  GEE M  +++  + LP +CG+   RC +
Sbjct  116  RQAVRRQQQQQGLRGEE-MEEMVQSARDLPKECGISSQRCEI 156

Sequence Alignment: 14. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 37.2 bits 186,  Expect = 0.0002
 Identities = 33/118 27%, Positives = 64/118 54%, Gaps = 14/118 11%
Query  3    LFLILAAA-----SLLIVASHADSQMRS--KCRKQMRMMEPQLEQCEGYMTMDMMDDDSM 55
            LF+  AAA     + + +    D+  R    CR+Q++  +  L +C+ Y+          
Sbjct  12   LFVANAAAFRTTITTMEIDEDIDNPRRRGESCREQIQRQQ-YLNRCQDYLRQQCRSG--- 67
Query  56   RGRECRSEESCMRGCCLAMKEMDDECMCEWMKMMVQQQRGEMG--EEDMRMVMRKMKQLP 113
             G +  ++    R CC  + +M+++C CE ++  V+QQ+ E G   E+M  +++    LP
Sbjct  68   -GYDEDNQRQHFRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGIRGEEMEEMVQCASDLP 126
Query  114  NKCGMGHMRCHM 125
             +CG+    C +
Sbjct  127  KECGISSRSCEI 138

Sequence Alignment: 15. Allergen Name: Ana o 3 Sequence ID: AAL91665

 Score = 36.2 bits 179,  Expect = 0.0004
 Identities = 32/110 29%, Positives = 64/110 58%, Gaps = 10/110 9%
Query  3    LFLILAAASLL--IVASHADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGREC 60
            ++L++A AS+   IV    DS     C++Q    + ++  C+ Y+  ++       GR  
Sbjct  13   VLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQ-RFRNCQRYVKQEVQRG----GRYN 67
Query  61   RSEESCMRGCCLAMKEMDDECMCEWMKMMVQQ--QRGEMGEEDMRMVMRKMKQLPNKCGM 118
            + +ES +R CC  ++E+D  C C+ ++ MV+Q  Q+ ++  E++R +     +LP  C +
Sbjct  68   QRQES-LRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELPRICSI 126

Sequence Alignment: 16. Allergen Name: Ses i 2 Sequence ID: AAD42943

 Score = 35.9 bits 177,  Expect = 0.0005
 Identities = 39/118 33%, Positives = 65/118 55%, Gaps = 18/118 15%
Query  6    ILAAASLLIVASH----ADSQMRSKCRKQMRMMEPQLEQCEGYMTMDMMDDDSMRGRE-- 59
            +L AA+L+  ++H      S       +  R  E +  QC+    M  M   SMRG+   
Sbjct  10   VLFAAALVSASAHKTVVTTSVAEEGEEENQRGCEWESRQCQMRHCMQWMR--SMRGQYEE 67
Query  60   --CRSEESCM------RGCCLAMKEMDDECMCEWMKMMVQQQRGEMG-EEDMRMVMRKMK 110
               RS E+        R CC  ++++   C CE ++ M++Q + E G E++M+ + + M+
Sbjct  68   SFLRSAEANQGQFEHFRECCNELRDVKSHCRCEALRCMMRQMQQEYGMEQEMQQMQQMMQ 127
Query  111  QLPNKCGMGH-MRCHM 125
             LP  CGM +   C M
Sbjct  128  YLPRMCGMSYPTECRM 143

Sequence Alignment: 17. Allergen Name: Ara h 6 Sequence ID: AAD56337

 Score = 34.0 bits 164,  Expect = 0.002
 Identities = 34/101 33%, Positives = 58/101 57%, Gaps = 16/101 15%
Query  25   SKCRKQMRMMEPQLEQCEGYMTMDMMDD----DSMRGRECRSEESCMRGCCLAMKEMDD- 79
            S C +Q+  +   L+ CE ++   +M +    DS      RS +   R CC  + EM++ 
Sbjct  17   SSCERQVDGVN--LKPCEQHIMQRIMGEQEQYDSYNFGSTRSSDQQQR-CCDELNEMENT 73
Query  80   -ECMCEWMKMMVQQQRGEMGEEDMRMVM---RKMKQLPNKCGMGH-MRCHMGI-GTR 130
              CMCE ++ +++ Q    G +D +MV    R++  LP +C  G   RC + + G R
Sbjct  74   QRCMCEALQQIMENQCD--GLQDRQMVQHFKRELMNLPQQCNFGAPQRCDLDVSGGR 128

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.