The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLFSLLLFLAFLLGTSAEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSP
TTTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFG
TTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVF
GKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPS
SHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLG
VSYGNNLDCYNQKPFA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q42428 Cas s 5 316 2226 458.1 2e-130
Q8VXF1 Mus a 2.0101 318 1611 333.7 5.7e-93
CAB01591 Pers a 1 326 1568 325.0 2.4e-90
CAC42881 Hev b 11.0101 295 1450 301.2 3.2e-83
CAD24068 Hev b 11.0102 295 1446 300.4 5.6e-83
P29022 Zea m 8.0101 280 427 94.4 5.6e-21
P0DKH8 Fag e 4.0102 40 240 58.0 7.1e-11
Exo m 1.0101 40 240
P02877 Hev b 6.01 204 251 59.0 1.8e-10
AAA34256 Tri a 18 212 223 53.3 9.6e-09
AAA34258 Tri a 18 213 220 52.7 1.5e-08
AAA34257 Tri a 18 186 210 50.8 4.9e-08
P81729 Bra r 2 91 166 42.4 7.9e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 458.1 bits 2226,  Expect = 2e-130
 Identities = 316/316 100%, Positives = 316/316 100%, Gaps = 0/316 0%
Query  1    MKLFSLLLFLAFLLGTSAEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSP 60
            MKLFSLLLFLAFLLGTSAEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSP
Sbjct  1    MKLFSLLLFLAFLLGTSAEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSP 60
Query  61   TTTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFG 120
            TTTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFG
Sbjct  61   TTTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFG 120
Query  121  TTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVF 180
            TTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVF
Sbjct  121  TTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVF 180
Query  181  GKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPS 240
            GKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPS
Sbjct  181  GKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPS 240
Query  241  SHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLG 300
            SHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLG
Sbjct  241  SHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLG 300
Query  301  VSYGNNLDCYNQKPFA 316
            VSYGNNLDCYNQKPFA
Sbjct  301  VSYGNNLDCYNQKPFA 316

Sequence Alignment: 2. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 333.7 bits 1611,  Expect = 6e-93
 Identities = 226/307 73%, Positives = 255/307 83%, Gaps = 12/307 3%
Query  1    MKLFSLLLF-LAFLLGTSAEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSS 59
            MK + L++F LA  LG  AEQCGRQAGGA C   LCCSQ+GWCGNT  YCG GCQSQC  
Sbjct  1    MKALLLVIFTLASSLGAFAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQCGG 60
Query  60   PTTTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGF 119
                     +   GGG V S+IS+SLF+QMLK+RND  C   GFYTYNAFIAAA SF+GF
Sbjct  61   ---------SGGSGGGSVASIISSSLFEQMLKHRNDAACPGKGFYTYNAFIAAANSFSGF 111
Query  120  GTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQT-YCTSKS-WP 177
            GTTGD   +KRE+AAFLAQTSHETTGGWATAPDGPYAWGYCFV E N  + YC + S WP
Sbjct  112  GTTGDDAKKKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWP 171
Query  178  CVFGKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQAN 237
            C  GK+YYGRGPIQ++ NYNYG AG+AIG+DL+NNPDLVAT+ TISFKTA+WFWMTPQ+ 
Sbjct  172  CAAGKKYYGRGPIQISFNYNYGPAGRAIGSDLLNNPDLVATDATISFKTALWFWMTPQSP 231
Query  238  KPSSHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCD 297
            KPS HDVI G+W PS AD +AGR+P YGV TNIINGGLECG G D RVA+RIGFYKRYCD
Sbjct  232  KPSCHDVITGSWTPSNADQAAGRLPGYGVTTNIINGGLECGKGYDARVADRIGFYKRYCD 291
Query  298  TLGVSYGNNLDCYNQKPFA 316
             LGVSYG+NLDCYNQ+PFA
Sbjct  292  LLGVSYGDNLDCYNQRPFA 310

Sequence Alignment: 3. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 325.0 bits 1568,  Expect = 2e-90
 Identities = 219/301 72%, Positives = 252/301 83%, Gaps = 12/301 3%
Query  6    LLLFLAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSPTTTT 64
            LLL++ +L G + AEQCGRQAGGA C   LCCSQFGWCG+T++YCG  CQSQC      T
Sbjct  12   LLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGG---VT 68
Query  65   SSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGD 124
             SP      GG V SLIS S+F+QMLK+RND  C++ GFYTYNAFIAAA SFNGF + GD
Sbjct  69   PSP------GGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGD 122
Query  125  VTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMEN-NKQTYCT-SKSWPCVFGK 182
              TRKRE+AAFLAQTSHETTGGWATAPDGPYAWGYCF+ E  N   YC  +  WPC  GK
Sbjct  123  TATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGK 182
Query  183  QYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSH 242
            +YYGRGPIQ+++NYNYG AG+AIG DLINNPD VAT+P ISFKTA+WFWMTPQ+ KPS H
Sbjct  183  KYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCH 242
Query  243  DVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLGVS 302
            +VI G W PSAAD +AGR+P YGVITNIINGG+ECG G +D+VA+RIGFYKRYCD LGVS
Sbjct  243  NVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVS 302
Query  303  YGNNLDCYNQKPF 315
            YG+NLDCYNQ+ F
Sbjct  303  YGSNLDCYNQRSF 315

Sequence Alignment: 4. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 301.2 bits 1450,  Expect = 3e-83
 Identities = 200/290 68%, Positives = 229/290 78%, Gaps = 9/290 3%
Query  19   EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSPTTTTSSPTASSGGGGDVG 78
            EQCGRQAGGA C   LCCSQ+GWC NT EYCG+GCQSQC               GG D+G
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC-------DGGGGGEDGGIDLG 53
Query  79   SLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGDVTTRKRELAAFLAQ 138
            S+IS S F++MLK+RND  C + GFYTY+AFI+AA++F  FGTTGDV T KRE+AAF+ Q
Sbjct  54   SIISRSTFEEMLKHRNDAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQ 113
Query  139  TSHETTGGWATAPDGPYAWGYCFVME-NNKQTYCT-SKSWPCVFGKQYYGRGPIQLTHNY 196
            TSH TTGGW TAPDGPYAWGYC+  E N   +YC+ S ++PC  GK+YYGRGPIQL+ NY
Sbjct  114  TSHATTGGWPTAPDGPYAWGYCYKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY 173
Query  197  NYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSHDVIIGNWRPSAADT 256
            NYGQ G+A+G DL+NNPDLVAT+  ISFK AIWFWMTPQ  KPS HDVI G W P+  D 
Sbjct  174  NYGQCGQALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDI 233
Query  257  SAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLGVSYGNNLDCYNQKPF 315
            SAGR P YGVITNIINGGLECG G D RV +RIGFYKRYCD + V YG+NLDCYNQ PF
Sbjct  234  SAGRAPGYGVITNIINGGLECGRGWDARVEDRIGFYKRYCDMFAVGYGSNLDCYNQTPF 292

Sequence Alignment: 5. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 300.4 bits 1446,  Expect = 6e-83
 Identities = 200/290 68%, Positives = 229/290 78%, Gaps = 9/290 3%
Query  19   EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSPTTTTSSPTASSGGGGDVG 78
            EQCGRQAGGA C   LCCSQ+GWC NT EYCG+GCQSQC              GG  D+G
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC-------DGGVGGEGGCVDLG 53
Query  79   SLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGDVTTRKRELAAFLAQ 138
            S+IS S F++MLK+RN+  C + GFYTY+AFI+AA++F  FGTTGDV T KRE+AAF+ Q
Sbjct  54   SIISRSTFEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQ 113
Query  139  TSHETTGGWATAPDGPYAWGYCFVME-NNKQTYCT-SKSWPCVFGKQYYGRGPIQLTHNY 196
            TSH TTGGW TAPDGPYAWGYC   E N   +YC+ S ++PC  GK+YYGRGPIQL+ NY
Sbjct  114  TSHATTGGWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNY 173
Query  197  NYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSHDVIIGNWRPSAADT 256
            NYGQ G+A+G DL+NNPDLVAT+  ISFK AIWFWMTPQ  KPS HDVI G W P+  D 
Sbjct  174  NYGQCGQALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDI 233
Query  257  SAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLGVSYGNNLDCYNQKPF 315
            SAGR P YGVITNIINGGLECG G D RV +RIGFYKRYCD +GV YG+NLDCYNQ PF
Sbjct  234  SAGRAPGYGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPF 292

Sequence Alignment: 6. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 94.4 bits 427,  Expect = 6e-21
 Identities = 114/264 43%, Positives = 168/264 63%, Gaps = 49/264 18%
Query  4    FSLLLFLAFLLGTSAEQ-CGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-QCSSPT 61
            + LL +L    G +A Q CG       C  N+CCS+FG+CG T  YCG GCQS  C S  
Sbjct  10   LGLLALLCAAAGPAAAQNCG-------CQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGG 62
Query  62   TTTSSPTASSGGGG--DVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGF 119
                      GG G  +V ++++ ++F+ + K +    C+   FYT +AF++A  ++ GF
Sbjct  63   GGGGGGGGGGGGSGGANVANVVTDAFFNGI-KNQAGSGCEGKNFYTRSAFLSAVNAYPGF 121
Query  120  GTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQT-YC--TSKSW 176
               G     KRE+AAF+A+ +HET         G +    C++ E NK   YC  +++ W
Sbjct  122  AHGGTEVEGKREIAAFFAHVTHET---------GHF----CYISEINKSNAYCDASNRQW 168
Query  177  PCVFGKQYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQA 236
            PC  G++YYGRGP+Q++ NYNYG AG+ IG + + +P+ VA +  I+FKTA+WFWM    
Sbjct  169  PCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMN--- 225
Query  237  NKPSSHDVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYC 296
               + H V+     P            +G     ING LEC   +  ++  R+G+YK+YC
Sbjct  226  ---NVHGVM-----PQG----------FGATIRAINGALECNGNNPAQMNARVGYYKQYC 267
Query  297  DTLGVSYGNNLDC 309
              L V  G NL C
Sbjct  268  QQLRVDPGPNLIC 280

Sequence Alignment: 7. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 58.0 bits 240,  Expect = 7e-11
 Identities = 27/38 71%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  20   QCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQC 57
            QCG Q GGA C   LCCSQ+GWCG+T +YCGAGCQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 8. Allergen Name: Exo Sequence ID:

 Score = 58.0 bits 240,  Expect = 7e-11
 Identities = 27/38 71%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  20   QCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQC 57
            QCG Q GGA C   LCCSQ+GWCG+T +YCGAGCQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 9. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 59.0 bits 251,  Expect = 2e-10
 Identities = 37/69 53%, Positives = 45/69 65%, Gaps = 5/69 7%
Query  1    MKLFSLLLFLAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGA--GCQSQC 57
            M +F  ++ L  L G + AEQCGRQAGG  C NNLCCSQ+GWCG+T EYC     CQS C
Sbjct  1    MNIF--IVVLLCLTGVAIAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNC 58
Query  58   SSPTTTTSSPTASS 71
                      +AS+
Sbjct  59   KDSGEGVGGGSASN 72

Sequence Alignment: 10. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 53.3 bits 223,  Expect = 1e-08
 Identities = 61/160 38%, Positives = 81/160 50%, Gaps = 32/160 20%
Query  10   LAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSSPT 61
            LAF   T+ A++CG Q     C NNLCCSQ+G+CG   +YCG GCQ+       +C S  
Sbjct  17   LAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQA 76
Query  62   ---TTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSN--GFYTYNAFIAAARSF 116
               T T++   S  G    G+    +   Q    R D +C S   G    N +  +   F
Sbjct  77   GGATCTNNQCCSQYGYCGFGAEYCGAGC-QGGPCRADIKCGSQAGGKLCPNNLCCSQWGF 135
Query  117  NGFGTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSW 176
             G+G+         E+     Q+   +T      P G  A G   V  NN   YC SK  
Sbjct  136  CGLGS---------EFCGGGCQSGACST----DKPCGKDAGGR--VCTNN---YCCSKWG 177
Query  177  PCVFGKQYYGRG 188
             C  G  Y G G
Sbjct  178  SCGIGPGYCGAG 189

Sequence Alignment: 11. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 52.7 bits 220,  Expect = 1e-08
 Identities = 61/162 37%, Positives = 82/162 50%, Gaps = 32/162 19%
Query  8    LFLAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSS 59
            +FLAF   T+ A++CG Q     C NNLCCSQ+G+CG   +YCG GCQ+       +C S
Sbjct  16   VFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGS 75
Query  60   PTTTTSSPTA---SSGGGGDVGSLISASLFDQMLKYRNDPRC--KSNGFYTYNAFIAAAR 114
                 + P     S  G    G+    +   Q    R D +C  +S G    N +  +  
Sbjct  76   QAGGATCPNNHCCSQYGHCGFGAEYCGAGC-QGGPCRADIKCGSQSGGKLCPNNLCCSQW 134
Query  115  SFNGFGTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSK 174
             F G+G+         E+     Q+   +T      P G  A G   V  NN   YC SK
Sbjct  135  GFCGLGS---------EFCGGGCQSGACSTD----KPCGKDAGGR--VCTNN---YCCSK 176
Query  175  SWPCVFGKQYYGRG 188
               C  G  Y G G
Sbjct  177  WGSCGIGPGYCGAG 190

Sequence Alignment: 12. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 50.8 bits 210,  Expect = 5e-08
 Identities = 55/151 36%, Positives = 73/151 48%, Gaps = 31/151 20%
Query  19   EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSSPTTTTSSPTA-- 69
            ++CG Q  G  C NNLCCSQ+G+CG   +YCG GCQ+       +C S     + P    
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
Query  70   -SSGGGGDVGSLISASLFDQMLKYRNDPRCKSN--GFYTYNAFIAAARSFNGFGTTGDVT 126
             S  G    G+    +   Q    R D +C S   G    N +  +   + G+G+     
Sbjct  61   CSQYGHCGFGAEYCGAGC-QGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGS----- 114
Query  127  TRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSWPCVFGKQYYG 186
                E+     Q    +T      P G  A G   V  NN   YC SK   C  G  Y G
Sbjct  115  ----EFCGEGCQNGACSTD----KPCGKDAGGR--VCTNN---YCCSKWGSCGIGPGYCG 161
Query  187  RG 188
             G
Sbjct  162  AG 163

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 42.4 bits 166,  Expect = 8e-06
 Identities = 20/32 62%, Positives = 25/32 78%, Gaps = 2/32 6%
Query  24   QAGGAACANNLCCSQFGWCGNTAEYCGA--GCQS 55
            QAGG  CA N+CCSQ+G+CG TA+YC     CQ+
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQA 34

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.