The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLHQGLVCLSVLILLPTCILGDRKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDL
FRGDKISLLYHPGAFPAITRNKTTNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNF
SGLAVIDFELWRPIFRQNGGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSF
IKQTLIKAKKLRPKAQWGYYAFPYCFNGRRRYVDTCIPSAKIDNDRILYMFENSDVIYPA
VYLQTDLAQKNQTGLVKGRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLEYISKENTTA
VFKAMKDNGADGVIIWGSSFDLNSKEKCAKFLDYLREVLWPVIDEVKRS
Sequence Info Allergen Name Length Opt Bits Score E Value
ADM18346 Tab y 2.0101 349 2345 541.0 2.8e-155
Q08169 Api m 2 382 974 228.4 3.7e-61
P49371 Dol m 2 331 922 216.6 1.2e-57
P49370 Ves v 2.0101 331 922 216.6 1.2e-57
Q9U6V9 Pol a 2 367 910 213.9 8.7e-57
XP_015179722 Pol d 2.0101 365 897 210.9 6.8e-56
P86687 Poly p 2.0101 288 798 188.4 3.1e-49
AAX14718 Ves v 2.0201 340 755 178.5 3.4e-46
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tab y 2.0101 Sequence ID: ADM18346

 Score = 541.0 bits 2345,  Expect = 3e-155
 Identities = 349/349 100%, Positives = 349/349 100%, Gaps = 0/349 0%
Query  1    MKLHQGLVCLSVLILLPTCILGDRKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDL 60
            MKLHQGLVCLSVLILLPTCILGDRKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDL
Sbjct  1    MKLHQGLVCLSVLILLPTCILGDRKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDL 60
Query  61   FRGDKISLLYHPGAFPAITRNKTTNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNF 120
            FRGDKISLLYHPGAFPAITRNKTTNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNF
Sbjct  61   FRGDKISLLYHPGAFPAITRNKTTNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNF 120
Query  121  SGLAVIDFELWRPIFRQNGGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSF 180
            SGLAVIDFELWRPIFRQNGGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSF
Sbjct  121  SGLAVIDFELWRPIFRQNGGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSF 180
Query  181  IKQTLIKAKKLRPKAQWGYYAFPYCFNGRRRYVDTCIPSAKIDNDRILYMFENSDVIYPA 240
            IKQTLIKAKKLRPKAQWGYYAFPYCFNGRRRYVDTCIPSAKIDNDRILYMFENSDVIYPA
Sbjct  181  IKQTLIKAKKLRPKAQWGYYAFPYCFNGRRRYVDTCIPSAKIDNDRILYMFENSDVIYPA 240
Query  241  VYLQTDLAQKNQTGLVKGRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLEYISKENTTA 300
            VYLQTDLAQKNQTGLVKGRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLEYISKENTTA
Sbjct  241  VYLQTDLAQKNQTGLVKGRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLEYISKENTTA 300
Query  301  VFKAMKDNGADGVIIWGSSFDLNSKEKCAKFLDYLREVLWPVIDEVKRS 349
            VFKAMKDNGADGVIIWGSSFDLNSKEKCAKFLDYLREVLWPVIDEVKRS
Sbjct  301  VFKAMKDNGADGVIIWGSSFDLNSKEKCAKFLDYLREVLWPVIDEVKRS 349

Sequence Alignment: 2. Allergen Name: Api m 2 Sequence ID: Q08169

 Score = 228.4 bits 974,  Expect = 4e-61
 Identities = 140/321 43%, Positives = 217/321 67%, Gaps = 4/321 1%
Query  24   RKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITRNKT 83
            R+F VYWN+PTFMC        ++++K+G++QN  D FRG++I++LY PG FPA+ ++  
Sbjct  41   REFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPN 100
Query  84   TNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGGSLS 143
             N ++  NGGVPQ GNL+ HL+++   +  QI DK+F G+ VIDFE WRPIFRQN  SL 
Sbjct  101  GN-VVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQ 159
Query  144  DYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYYAFP 203
             Y+ LS+++ +  HP +++ ++ +EA+RR EK+G+ F+++TL  AK++RP A WGYYA+P
Sbjct  160  PYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYP 219
Query  204  YCFNGRRRYVDT-CIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGRVDE 262
            YC+N         C  +   +ND++ ++FE+ DV+ P+VYL+ +L    + GLV GRV E
Sbjct  220  YCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKE 279
Query  263  AVRMAKMVKKPAKPPVLVYHRYVFTDTLEY-ISKENTTAVFKAMKDNGADGVIIWGSSFD 321
            A+R+A+ +    K  VL Y+ Y + D  +  +S+ +  A ++ + D GADG IIWGSS D
Sbjct  280  ALRIARQMTTSRKK-VLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDD 338
Query  322  LNSKEKCAKFLDYLREVLWPVIDEV 346
            +N+K KC +F +YL   L P +  +
Sbjct  339  INTKAKCLQFREYLNNELGPAVKRI 363

Sequence Alignment: 3. Allergen Name: Dol m 2 Sequence ID: P49371

 Score = 216.6 bits 922,  Expect = 1e-57
 Identities = 136/322 42%, Positives = 212/322 65%, Gaps = 6/322 1%
Query  24   RKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITRNKT 83
            R F +YWN+PTFMC  Q     D      + +N++D F+GDKIS++Y PG FPA+   K 
Sbjct  6    RVFNIYWNVPTFMC-HQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALLPLKE 64
Query  84   TNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGGSLS 143
             N  I  NGGVPQ GN+++HL+ + +++++   ++NF+G+ VIDFE WRPIFRQN G++ 
Sbjct  65   GNYKI-RNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMM 123
Query  144  DYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYYAFP 203
             ++ +S+ L ++ HP +++  +  EA +R EK+ R F+++TL  AKK R +A WGYY +P
Sbjct  124  IHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYP 183
Query  204  YCFN-GRRRYVDTCIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGRVDE 262
            YCFN      V  C  +A ++ND++ ++F N +V+ P+VY++ +L    + GLV+GRV E
Sbjct  184  YCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGRVKE 243
Query  263  AVRMAKMVKKPAKPPVLVYHRYVFTD-TLEYISKENTTAVFKAMKDNGADGVIIWGSSFD 321
            AVR++  +K    P VL Y  YV+ D T  ++++ +    F+ +  NG DG+IIWGSS D
Sbjct  244  AVRISNNLKH--SPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSD 301
Query  322  LNSKEKCAKFLDYLREVLWPVIDEVKRS 349
            +NS  KC ++ +YL  VL P+   V  +
Sbjct  302  VNSLSKCKRLREYLLTVLGPITVNVTET 329

Sequence Alignment: 4. Allergen Name: Ves v 2.0101 Sequence ID: P49370

 Score = 216.6 bits 922,  Expect = 1e-57
 Identities = 136/315 43%, Positives = 208/315 66%, Gaps = 6/315 1%
Query  24   RKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITRNKT 83
            R F +YWN+PTFMC  Q     D      + +N++D F+GDKI+++Y PG FPA+   K 
Sbjct  6    RVFNIYWNVPTFMC-HQYDLYFDEVTNFNIKRNSKDDFQGDKIAIFYDPGEFPALLSLKD 64
Query  84   TNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGGSLS 143
                   NGGVPQ GN+++HL+ + +++++   ++NFSG+ VIDFE WRPIFRQN G++ 
Sbjct  65   -GKYKKRNGGVPQEGNITIHLQKFIENLDKIYPNRNFSGIGVIDFERWRPIFRQNWGNMK 123
Query  144  DYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYYAFP 203
             ++N+S+ L ++ HP +N+  +  EA +R EK+ R F+++TL  AKK R +A WGYY +P
Sbjct  124  IHKNFSIDLVRNEHPTWNKKMIELEASKRFEKYARFFMEETLKLAKKTRKQADWGYYGYP 183
Query  204  YCFN-GRRRYVDTCIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGRVDE 262
            YCFN      V  C  +A  +ND++ ++F N +V+ P+VY++ +L    + GLV+GRV E
Sbjct  184  YCFNMSPNNLVPECDVTAMHENDKMSWLFNNQNVLLPSVYVRQELTPDQRIGLVQGRVKE 243
Query  263  AVRMAKMVKKPAKPPVLVYHRYVFTD-TLEYISKENTTAVFKAMKDNGADGVIIWGSSFD 321
            AVR++  +K    P VL Y  YV+ D T  ++++ +    F+ +  NG DG+IIWGSS D
Sbjct  244  AVRISNNLKH--SPKVLSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSD 301
Query  322  LNSKEKCAKFLDYLREVLWPV 342
            +NS  KC ++ DYL  VL P+
Sbjct  302  VNSLSKCKRLQDYLLTVLGPI 322

Sequence Alignment: 5. Allergen Name: Pol a 2 Sequence ID: Q9U6V9

 Score = 213.9 bits 910,  Expect = 9e-57
 Identities = 135/309 43%, Positives = 207/309 66%, Gaps = 16/309 5%
Query  24   RKFEVYWNIPTFMCPDQNKT---IMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITR 80
            R F +YWN+PTFMC         + D+N KH    N++D FRG+ IS+ Y PG FPA+  
Sbjct  35   RVFSIYWNVPTFMCHQYGMNFDEVTDFNIKH----NSKDNFRGETISIYYDPGKFPALMP 90
Query  81   NKTTNTLIYE--NGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQN 138
             K  N   YE  NGGVPQ GN+++HL+ + +D+++   DKNF G+ VIDFE W+PIFRQN
Sbjct  91   LKNGN---YEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQN 147
Query  139  GGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWG 198
             G+   ++  S++L +  HP+++E  +  EA ++ EK+ R F+++TL  AKK R +A+WG
Sbjct  148  WGNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWG 207
Query  199  YYAFPYCFNGRRRYVDT-CIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVK 257
            YY FPYC+N         C   A I+NDR+ +M+ N ++++P+VY++ +   + +  LV+
Sbjct  208  YYGFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQ 267
Query  258  GRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLE-YISKENTTAVFKAMKDNGADGVIIW 316
            GR+ EAVR++  ++    P VL Y  YV+ D ++ Y+S+ +    F+ +  NG DG+IIW
Sbjct  268  GRIKEAVRISNNLEH--SPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIW 325
Query  317  GSSFDLNSKEKCAKFLDYLREVLWP 341
            GSS D+NS  KC ++ +YL   L P
Sbjct  326  GSSSDVNSLSKCKRLREYLLNTLGP 350

Sequence Alignment: 6. Allergen Name: Pol d 2.0101 Sequence ID: XP_015179722

 Score = 210.9 bits 897,  Expect = 7e-56
 Identities = 131/320 40%, Positives = 205/320 64%, Gaps = 11/320 3%
Query  24   RKFEVYWNIPTFMCPDQNKT---IMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITR 80
            R F +YWN+PTFMC         + D+N KH    N++D FRG+ I++ Y PG FPA+  
Sbjct  32   RVFSIYWNVPTFMCHQYGMNFDEVTDFNIKH----NSKDNFRGETIAIYYDPGKFPALMP 87
Query  81   NKTTNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGG 140
                      NGGVPQ GN+++HL+ + +D+++   D+NF G+ VIDFE WRPIFRQN G
Sbjct  88   LNNNGKYEERNGGVPQLGNITIHLQQFNEDLDKMTPDRNFGGIGVIDFERWRPIFRQNWG 147
Query  141  SLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYY 200
            +   ++  S++L +  HP+++E  +  EA ++ EK+ R F+++TL  AKK R +A+WGYY
Sbjct  148  NTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKSRKRAKWGYY 207
Query  201  AFPYCFNGRRRYVDT-CIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGR 259
             FPYC+N         C   A I+NDR+ +M+ N +++ P+VYL+ +   + +  LV+GR
Sbjct  208  GFPYCYNVTPNNPGPDCDAKAIIENDRLSWMYNNQEILLPSVYLRHEQKPEERIYLVQGR 267
Query  260  VDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLE-YISKENTTAVFKAMKDNGADGVIIWGS 318
            + EAVR++  ++    P VL Y  YV+ D ++ Y+S+ +    F+ +  NG +G+IIWGS
Sbjct  268  IKEAVRISNNLEH--SPSVLAYWWYVYQDKMDIYLSETDVKKTFQEIVTNGGNGIIIWGS 325
Query  319  SFDLNSKEKCAKFLDYLREVLWPVIDEVKRS 349
            S D+NS  KC ++ +YL   L P+   V  +
Sbjct  326  SSDVNSLSKCKRLREYLLNTLGPIAVNVTET 356

Sequence Alignment: 7. Allergen Name: Poly p 2.0101 Sequence ID: P86687

 Score = 188.4 bits 798,  Expect = 3e-49
 Identities = 118/274 43%, Positives = 183/274 66%, Gaps = 9/274 3%
Query  63   GDKISLLYHPGAFPAITRNKTTNTLIYE--NGGVPQAGNLSLHLKLLEKDINEQITDKNF 120
            G+ IS+ Y PG FPA+   K  N   YE  NGGVPQ GN+++HL+ + +D+++   DKNF
Sbjct  1    GETISIYYDPGKFPALMPLKNGN---YEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNF 57
Query  121  SGLAVIDFELWRPIFRQNGGSLSDYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSF 180
             G+ VIDFE W+PIFRQN G+   ++  S++L +  HP+++E  +  EA ++ EK+ R F
Sbjct  58   GGIGVIDFERWKPIFRQNWGNTEIHKKYSIELVRYEHPKWSESMIEAEATKKFEKYARLF 117
Query  181  IKQTLIKAKKLRPKAQWGYYAFPYCFNGRRRYVDT-CIPSAKIDNDRILYMFENSDVIYP 239
            +++TL  AKK R +A+WGYY FPYC+N         C   A I+NDR+ +M+ N ++++P
Sbjct  118  MEETLKLAKKTRKRAKWGYYGFPYCYNYTPNNPGPDCDAKAMIENDRLSWMYNNQEILFP 177
Query  240  AVYLQTDLAQKNQTGLVKGRVDEAVRMAKMVKKPAKPPVLVYHRYVFTDTLE-YISKENT 298
            +VY++ +L    +  LV+GR+ EAVR++  +K    P VL Y  YV+ D ++ ++S+ + 
Sbjct  178  SVYVRHELTPDQRVYLVQGRIKEAVRISNNLKH--SPKVLSYWWYVYQDKMDIFLSETDV 235
Query  299  TAVFKAMKDNGADGVIIWGSSFDLNSKEKCAKFLDYLREVLWP 341
               F+ +  NG DG+IIWGSS D+NS  KC ++ +YL   L P
Sbjct  236  KKTFQEIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGP 278

Sequence Alignment: 8. Allergen Name: Ves v 2.0201 Sequence ID: AAX14718

 Score = 178.5 bits 755,  Expect = 3e-46
 Identities = 115/322 35%, Positives = 197/322 61%, Gaps = 6/322 1%
Query  24   RKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITRNKT 83
            + F +YWNIPT  C +      +L K+  +  N+ + FRG+ ISL+Y PG FP++   K 
Sbjct  8    KGFSIYWNIPTHFCHNFGVYFKEL-KQFNIKYNSMNNFRGETISLFYDPGNFPSMVLLKN 66
Query  84   TNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGGSLS 143
              T    N GVPQ GNL++HL+ + K+++E    K   G+ VI F  WRPIFR+N  +L 
Sbjct  67   -GTYEIRNEGVPQKGNLTIHLEQFTKELDEIYPKKIAGGIGVIHFHNWRPIFRRNVDNLK 125
Query  144  DYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYYAFP 203
              +++S+ L +  HP++++  + KEA  R E   + F+++TL  AK++R K +WGY+ +P
Sbjct  126  INKDISIDLVRKEHPKWDKSMIEKEASNRFETSAKIFMEKTLKLAKEIRKKTEWGYHGYP 185
Query  204  YCFNGRRRYVD-TCIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGRVDE 262
            +C++G        C   +  +ND++ ++F N +V+ P++YL+  L    +  LV+ R+ E
Sbjct  186  HCLSGSTDKPSFDCDALSMSENDKMSWLFNNQNVLLPSIYLKNVLKPDEKIHLVQERLKE 245
Query  263  AVRMAKMVKKPAKPPVLVYHRYVFTDTLE-YISKENTTAVFKAMKDNGADGVIIWGSSFD 321
            A+R++K  K    P VL Y  Y + D    ++++ +    FK +  NGADG+IIWG S++
Sbjct  246  AIRISKNFKH--LPKVLPYWWYTYQDKESIFLTEADVKNTFKEILTNGADGIIIWGVSYE 303
Query  322  LNSKEKCAKFLDYLREVLWPVIDEVKRS 349
            L  +++C K+ +YL ++L P+  +V ++
Sbjct  304  LTDRKRCEKLKEYLMKILGPIAFKVTKA 331

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.