The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH
IKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLH
LLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVNILDLTEVDRCLQARGSEVA
QDSSVE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAS77253 Fel d 4 186 1201 280.7 1.8e-77
XP_855342 Can f 6.0101 190 820 193.9 2.5e-51
Q95182 Equ c 1 187 804 190.2 3.1e-50
P02761 Rat n 1 181 674 160.6 2.5e-41
U6C8D6 Ory c 4.0101 172 649 154.9 1.2e-39
S0BDX9 Cav p 6.0101 181 639 152.6 6.2e-39
P02762 Mus m 1 180 610 146.0 6e-37
AAA39768 Mus m 1.0102 180 607 145.3 9.7e-37
Q9QXU1 Mes a 1.0101 172 296 74.5 2e-15
Q28133 Bos d 2.0101 172 281 71.1 2.1e-14
A59225 Bos d 2.0102 156 267 67.9 1.7e-13
B59225 Bos d 2.0103 156 253 64.7 1.5e-12
CAX62130 Cav p 3.0101 170 243 62.4 8.5e-12
O18874 Can f 2 180 236 60.8 2.8e-11
P02754 Bos d 5 178 233 60.1 4.4e-11
CAA32835 Bos d 5 178 227 58.7 1.1e-10
O18873 Can f 1 174 202 53.0 5.7e-09
AAA30411 Bos d 5 151 196 51.8 1.2e-08
ADK56160 Fel d 7.0101 180 168 45.3 1.3e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 280.7 bits 1201,  Expect = 2e-77
 Identities = 186/186 100%, Positives = 186/186 100%, Gaps = 0/186 0%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH
Sbjct  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
Query  61   IKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLH 120
            IKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLH
Sbjct  61   IKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLH 120
Query  121  LLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVNILDLTEVDRCLQARGSEVA 180
            LLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVNILDLTEVDRCLQARGSEVA
Sbjct  121  LLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVNILDLTEVDRCLQARGSEVA 180
Query  181  QDSSVE 186
            QDSSVE
Sbjct  181  QDSSVE 186

Sequence Alignment: 2. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 193.9 bits 820,  Expect = 3e-51
 Identities = 132/186 70%, Positives = 156/186 83%, Gaps = 4/186 2%
Query  1    MKLLLLCLGLILVCAHEEEN-VVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVE 59
            MKLLLLCLGLILV AHEEEN VV+ N DISKISG+WYSILLASD+KEKIEENGSMRVFV+
Sbjct  1    MKLLLLCLGLILVHAHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK 60
Query  60   HIKALDNSSLSFVFHTKENGKCTEIFLVADKT-KDGVYTVVYDGYNVFSIVETVYDEYIL 118
             I+ L NSSL F  HTK NGKCT+I L+ +KT KDG Y VV+DGYN+F I+ET Y++YI+
Sbjct  61   DIEVLSNSSLIFTMHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYII 120
Query  119  LHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARG 176
            +HL N ++ + FQL+E+Y R+PDVS K+KEKFV+YCQ   I   NILDLT+VDRCLQAR 
Sbjct  121  FHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQARQ 180
Query  177  SEVAQDSSVE 186
            SE AQ SS E
Sbjct  181  SEAAQVSSAE 190

Sequence Alignment: 3. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 190.2 bits 804,  Expect = 3e-50
 Identities = 130/181 71%, Positives = 155/181 85%, Gaps = 5/181 2%
Query  1    MKLLLLCLGLILVCAHEEEN--VVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFV 58
            MKLLLLCLGLILVCA++EEN  V   N DISKISGEWYSI+LASDVKEKIEENGSMRVFV
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFV 60
Query  59   EHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEYI 117
            + I+ALDNSSL   ++TK NG+CTE  +V DKT+ DGVY++ YDGYNVF I E   DE+I
Sbjct  61   DVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHI 120
Query  118  LLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQAR 175
            +L+L+NFDK RPFQL EFYAREPDVS ++KE+FVK  Q+ GIV  NI+DLT++DRC+Q R
Sbjct  121  ILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLR 180
Query  176  GSEVAQ 181
            G+ VAQ
Sbjct  181  GNGVAQ 186

Sequence Alignment: 4. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 160.6 bits 674,  Expect = 2e-41
 Identities = 102/173 58%, Positives = 135/173 78%, Gaps = 5/173 2%
Query  3    LLLLCLGLILVCAHEEE-NVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHI 61
            LLLLCLGL LVC H EE +  R N+D++K++G+W+SI++AS+ +EKIEENGSMRVF++HI
Sbjct  5    LLLLCLGLTLVCGHAEEASSTRGNLDVAKLNGDWFSIVVASNKREKIEENGSMRVFMQHI 64
Query  62   KALDNSSLSFVFHTKENGKCTEIFLVADKT-KDGVYTVVYDGYNVFSIVETVYDEYILLH 120
              L+NS L F F  KENG+C E++LVA KT +DG Y V YDG N F+I++T YD Y+++H
Sbjct  65   DVLENS-LGFKFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFH 123
Query  121  LLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARG 176
            L+NF     FQL+ +Y R  D+S  +KEKF K C+ HGI   NI+DLT+ DRCLQARG
Sbjct  124  LINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRCLQARG 181

Sequence Alignment: 5. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 154.9 bits 649,  Expect = 1e-39
 Identities = 104/169 61%, Positives = 130/169 76%, Gaps = 4/169 2%
Query  11   ILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHIKALDNSSLS 70
            IL+CA +  +   S+ ++S+ISGEWYS+LLASD +EKIEENGSMRVFVE+I    NSSLS
Sbjct  1    ILICAPKRGDA-HSHSEVSQISGEWYSVLLASDHREKIEENGSMRVFVEYIHVWKNSSLS 59
Query  71   FVFHTKENGKCTEIFLVADKTKDG-VYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRP 129
            F FHT  NGKCTE+FL  D T+D  VYTV YDG+NVFSI++ V D+YI++HL+N +    
Sbjct  60   FKFHTPVNGKCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGES 119
Query  130  FQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARGSEVA 180
            FQL+E+Y R  DV   ++EKFV+ CQE GIV  NILDLT+VDRCL AR    A
Sbjct  120  FQLMELYGRGLDVRSDIREKFVQLCQERGIVEENILDLTKVDRCLYARDGGAA 172

Sequence Alignment: 6. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 152.6 bits 639,  Expect = 6e-39
 Identities = 98/176 55%, Positives = 129/176 73%, Gaps = 3/176 1%
Query  1    MKLLLLCLGLILVCAHEE-ENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVE 59
            MKL LLCLGLIL+C + E + VVR N D  KISG WY++  ASD +E IEE GSMRVFVE
Sbjct  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
Query  60   HIKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
             I+ + +S+LSF F   ENG+C +I L+ ++  +GVY V YDGYNVF + ET Y  Y ++
Sbjct  61   SIEPVKDSALSFKFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYAIF 120
Query  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQARG 176
            +L NF     FQL+E+Y REPDVS ++K +F  +C+++GI   NI+D+T VDRCLQARG
Sbjct  121  QLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQARG 179

Sequence Alignment: 7. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 146.0 bits 610,  Expect = 6e-37
 Identities = 94/174 54%, Positives = 133/174 76%, Gaps = 6/174 3%
Query  1    MK-LLLLCLGLILVCAHEEE-NVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFV 58
            MK LLLLCLGL LVC H EE +    N ++ KI+GEW++I+LASD +EKIE+NG+ R+F+
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  59   EHIKALDNSSLSFVFHTKENGKCTEIFLVADKT-KDGVYTVVYDGYNVFSIVETVYDEYI 117
            E+I  L+NS L + FHT  + +C+E+ +VADKT K G Y+V YDG+N F+I +T YD ++
Sbjct  61   EQIHVLENS-LVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL 119
Query  118  LLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQAR 175
            + HL+N      FQL+ +Y REPD+S  +KE+F + C+EHGI+  NI+DL+  +RCLQAR
Sbjct  120  MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQAR 179

Sequence Alignment: 8. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 145.3 bits 607,  Expect = 1e-36
 Identities = 94/174 54%, Positives = 132/174 75%, Gaps = 6/174 3%
Query  1    MK-LLLLCLGLILVCAHEEE-NVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFV 58
            MK LLLLCLGL LVC H EE +    N ++ KI+GEW++I+LASD +EKIE+NG+ R+F+
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  59   EHIKALDNSSLSFVFHTKENGKCTEIFLVADKT-KDGVYTVVYDGYNVFSIVETVYDEYI 117
            E+I  L+ S L + FHT  + +C+E+ +VADKT K G Y+V YDG+N F+I +T YD ++
Sbjct  61   EQIHVLEKS-LVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFL 119
Query  118  LLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQAR 175
            + HL+N      FQL+ +Y REPD+S  +KE+F K C+EHGI+  NI+DL+  +RCLQAR
Sbjct  120  MAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQAR 179

Sequence Alignment: 9. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 74.5 bits 296,  Expect = 2e-15
 Identities = 55/168 32%, Positives = 96/168 57%, Gaps = 8/168 4%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            +K+LLL L L + CA + +N+    +  S++ G+W+S+ +A+D K K+ E G +RV+V+H
Sbjct  2    VKFLLLALALGVSCA-QHQNL---EVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKH 57
Query  61   IKALDN-SSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
            ++  D   +++  F+TK    C E  +V  K KDG Y   + G N F +VE   D+ + +
Sbjct  58   LECSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKA-DDTMTF 116
Query  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQ 173
            H +N D +    ++    +    S + K++F K  +++ I   NI  L   D C Q
Sbjct  117  HNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172

Sequence Alignment: 10. Allergen Name: Bos d 2.0101 Sequence ID: Q28133

 Score = 71.1 bits 281,  Expect = 2e-14
 Identities = 55/167 32%, Positives = 92/167 55%, Gaps = 7/167 4%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            MK ++L L + LVC  +E     + ID SKI GEW  I  A+D K+KI E G +R +   
Sbjct  1    MKAVFLTLLFGLVCTAQE---TPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRR 57
Query  61   IKAL-DNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
            I+ + D  SLS  F+ K+ G C  +  VA + +  VY + + G N + ++  V +  ++ 
Sbjct  58   IECINDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVT 116
Query  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVN--ILDLTEVDRC 171
            ++ N+D  R  ++ E  A+    + +  EK+ +   E G+ N  I +L + D C
Sbjct  117  YVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170

Sequence Alignment: 11. Allergen Name: Bos d 2.0102 Sequence ID: A59225

 Score = 67.9 bits 267,  Expect = 2e-13
 Identities = 48/147 32%, Positives = 81/147 55%, Gaps = 4/147 2%
Query  24   SNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHIKAL-DNSSLSFVFHTKENGKCT 82
            + ID SKI GEW  I  A+D K+KI E G +R +   I+ + D  SLS  F+ K+ G C 
Sbjct  5    AEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCL 64
Query  83   EIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRPFQLVEFYAREPDV 142
             +  VA + +  VY + +DG N + ++  V +  ++ ++ N+D  R  ++ E  A+    
Sbjct  65   LLTEVAKRQEGYVYVLEFDGTNTLEVIH-VSENMLVTYVENYDGERITKMTEGLAKGTSF 123
Query  143  SQKLKEKFVKYCQEHGIVN--ILDLTEVDRC 171
            + +  EK+ +   E G+ N  I +L + D C
Sbjct  124  TPEELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 12. Allergen Name: Bos d 2.0103 Sequence ID: B59225

 Score = 64.7 bits 253,  Expect = 2e-12
 Identities = 47/147 31%, Positives = 79/147 53%, Gaps = 4/147 2%
Query  24   SNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEHIKAL-DNSSLSFVFHTKENGKCT 82
            + ID SKI GEW  I  A+D K+KI E G +R +   I+ + D  SLS  F+ K+ G C 
Sbjct  5    AEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCL 64
Query  83   EIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRPFQLVEFYAREPDV 142
             +  VA + +  VY + + G N + ++  V +  ++ +  N+D  R  ++ E  A+    
Sbjct  65   LLTEVAKRQEGYVYVLEFYGTNTLEVIH-VSENMLVTYAENYDGERITKMTEGLAKGTSF 123
Query  143  SQKLKEKFVKYCQEHGIVN--ILDLTEVDRC 171
            + +  EK+ +   E G+ N  I +L + D C
Sbjct  124  TPEELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 13. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 62.4 bits 243,  Expect = 8e-12
 Identities = 52/165 31%, Positives = 94/165 56%, Gaps = 13/165 7%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            M++LLL L + L  AH+        +D S+I+G+W++I +A+D  EKI E G +R +  +
Sbjct  1    MQILLLALTIGLAYAHQ-------TLDPSEINGQWHTISIAADNVEKIGEGGPLRGYFHN 53
Query  61   IKALDN-SSLSFVFHTKENGKCTEIFLVADKTKDG-VYTVVYDGYNVFSIVETVYDEYIL 118
            +   D   ++ + F+ K +G C    ++  K +D  VY   Y G N F ++    D  I 
Sbjct  54   LHCYDGCKNIGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHFEVIGKKEDA-IA 112
Query  119  LHLLNFDKT-RPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIV--NILDLTEVDRCLQ 173
            ++  N D+T +  +++   AR   ++++ ++K+ +   E GI   NI  + E D C Q
Sbjct  113  FYNHNTDETGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTCAQ 170

Sequence Alignment: 14. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 60.8 bits 236,  Expect = 3e-11
 Identities = 49/174 28%, Positives = 92/174 52%, Gaps = 6/174 3%
Query  1    MKLLLLCLGLILVCA--HEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFV 58
            M+LLLL +GL L+C    +E N       + ++SG W+S+ LAS+  + I+  G  RVF+
Sbjct  1    MQLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFI 60
Query  59   EHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEYI 117
              + A D +    ++   ++G+C ++ L A KT     + + Y G+N + + E     Y+
Sbjct  61   HSMSAKDGNLHGDIL-IPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYL 119
Query  118  LLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVN--ILDLTEVDRCLQAR 175
            +L+++N        +  +  R+    Q +   F   C++ G+    I+ L++ DRC  +R
Sbjct  120  ILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSR 179

Sequence Alignment: 15. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 60.1 bits 233,  Expect = 4e-11
 Identities = 47/150 31%, Positives = 82/150 54%, Gaps = 6/150 4%
Query  1    MKLLLLCLGLILVCAHEEENVVRS--NIDISKISGEWYSILLA-SDVKEKIEENGSMRVF 57
            MK LLL L   L C  +   V ++   +DI K++G WYS+ +A SD+     ++  +RV+
Sbjct  1    MKCLLLALA--LTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
Query  58   VEHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEY 116
            VE +K      L  +++  ENG+C +  ++A+KTK   V+ +     N   +++T Y +Y
Sbjct  59   VEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKY 118
Query  117  ILLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVK 152
            +L+ + N  +       +   R P+V  +  EKF K
Sbjct  119  LLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDK 154

Sequence Alignment: 16. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 58.7 bits 227,  Expect = 1e-10
 Identities = 46/150 30%, Positives = 82/150 54%, Gaps = 6/150 4%
Query  1    MKLLLLCLGLILVCAHEEENVVRS--NIDISKISGEWYSILLA-SDVKEKIEENGSMRVF 57
            MK LLL L   L C  +   V ++   +DI K++G WYS+ +A SD+     ++  +RV+
Sbjct  1    MKCLLLALA--LTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVY 58
Query  58   VEHIKALDNSSLSFVFHTKENGKCTEIFLVADKTK-DGVYTVVYDGYNVFSIVETVYDEY 116
            VE +K      L  +++  EN +C +  ++A+KTK   V+ +     N   +++T Y +Y
Sbjct  59   VEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKY 118
Query  117  ILLHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVK 152
            +L+ + N  +     + +   R P+V  +  EKF K
Sbjct  119  LLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDK 154

Sequence Alignment: 17. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 53.0 bits 202,  Expect = 6e-09
 Identities = 50/166 30%, Positives = 86/166 51%, Gaps = 8/166 4%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            MK LLL +G+ L+   + ++      D   +SG+WY   + +D +E  E+  S+   +  
Sbjct  1    MKTLLLTIGFSLIAILQAQDTPALGKDTVAVSGKWYLKAMTAD-QEVPEKPDSVTPMI-- 57
Query  61   IKALDNSSLSFVFHTKENGKCTEIFLVADKTKD-GVYTVVYDGYNVFSIVET-VYDEYIL 118
            +KA    +L        NG+C  I +V  KT + G YT  Y+G  V  I  + V D YIL
Sbjct  58   LKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTA-YEGQRVVFIQPSPVRDHYIL 116
Query  119  LHLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVN-ILDLTEVDRC 171
             +       R  ++ ++  R+P+ SQ+  E F ++ +  G+   IL+L + + C
Sbjct  117  -YCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETC 169

Sequence Alignment: 18. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 51.8 bits 196,  Expect = 1e-08
 Identities = 36/125 28%, Positives = 68/125 54%, Gaps = 2/125 1%
Query  28   ISKISGEWYSILLA-SDVKEKIEENGSMRVFVEHIKALDNSSLSFVFHTKENGKCTEIFL 86
            I K++G WYS+ +A SD+     ++  +RV+VE +K      L  +++  EN +C +  +
Sbjct  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
Query  87   VADKTK-DGVYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRPFQLVEFYAREPDVSQK 145
            +A+KTK   V+ +     N   +++T Y +Y+L+ + N  +     + +   R P+V  +
Sbjct  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
Query  146  LKEKFVK 152
              EKF K
Sbjct  121  ALEKFDK 127

Sequence Alignment: 19. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 45.3 bits 168,  Expect = 1e-06
 Identities = 46/166 27%, Positives = 81/166 48%, Gaps = 9/166 5%
Query  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
            MK LLL +GL L+   + ++   S  D   +SG+WY   + +D +E   +   + V    
Sbjct  1    MKALLLAVGLSLITVLQAQDPPASGEDTMAMSGKWYLKAMITD-RETSWKKPEL-VTPMT 58
Query  61   IKALDNSSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVET-VYDEYILL 119
            +  L+  +L        NG+C E+ L+ +KT +      Y G  V  I  T V D YI+ 
Sbjct  59   LTVLEGGNLKAETTLLTNGQCKEVELILEKTSEPKKYTTYGGKRVVYIEPTEVKDHYIFY 118
Query  120  --HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGIVN-ILDLTEVDRC 171
                +  ++ R  +LV    R+P+ +++  E F ++ +  G    I+   + D C
Sbjct  119  CEGEMQGEQARMAKLV---GRDPESNEEALENFREFLRAKGFNQEIFSPKQSDTC 170

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.