The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKLLVPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKL
QVKECTDEIDKGKRVLIAAVLTKIVKECAL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9GK67 Ory c 3.B.0101 90 583 180.2 7.6e-48
CAA44344 Fel d 1 92 96 34.1 0.00073
P30439 Fel d 1 88 93 33.2 0.0013
AAC41617 Fel d 1 88 92 32.9 0.0016
CAA44343 Fel d 1 88 91 32.6 0.0019
AAC37318 Fel d 1 92 89 32.0 0.0031
P30438 Fel d 1 92 86 31.1 0.0058
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory c 3.B.0101 Sequence ID: Q9GK67

 Score = 180.2 bits 583,  Expect = 8e-48
 Identities = 90/90 100%, Positives = 90/90 100%, Gaps = 0/90 0%
Query  1    MKLLVPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKL 60
            MKLLVPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKL
Sbjct  1    MKLLVPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKL 60
Query  61   QVKECTDEIDKGKRVLIAAVLTKIVKECAL 90
            QVKECTDEIDKGKRVLIAAVLTKIVKECAL
Sbjct  61   QVKECTDEIDKGKRVLIAAVLTKIVKECAL 90

Sequence Alignment: 2. Allergen Name: Fel d 1 Sequence ID: CAA44344

 Score = 34.1 bits 96,  Expect = 0.0007
 Identities = 23/73 31%, Positives = 35/73 47%, Gaps = 1/73 1%
Query  12   LALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD-EID 70
            LAL     D   CPA   D   FL      Y +++A+Y+A P  +E    +K C D ++ 
Sbjct  13   LALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMT 72
Query  71   KGKRVLIAAVLTKI 84
            +  +    +VL KI
Sbjct  73   EEDKENALSVLDKI 86

Sequence Alignment: 3. Allergen Name: Fel d 1 Sequence ID: P30439

 Score = 33.2 bits 93,  Expect = 0.001
 Identities = 21/66 31%, Positives = 32/66 48%, Gaps = 1/66 1%
Query  19   ADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD-EIDKGKRVLI 77
            AD   CPA   D   FL      Y +++A+Y A P  +E    +K C D ++ +  +   
Sbjct  16   ADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENA 75
Query  78   AAVLTKI 84
             +VL KI
Sbjct  76   LSVLDKI 82

Sequence Alignment: 4. Allergen Name: Fel d 1 Sequence ID: AAC41617

 Score = 32.9 bits 92,  Expect = 0.002
 Identities = 17/49 34%, Positives = 23/49 46%, Gaps = 0/49 0%
Query  19   ADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD 67
            AD   CPA   D   FL      Y +++A+Y A P  +E    +K C D
Sbjct  16   ADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVD 64

Sequence Alignment: 5. Allergen Name: Fel d 1 Sequence ID: CAA44343

 Score = 32.6 bits 91,  Expect = 0.002
 Identities = 20/65 30%, Positives = 32/65 49%, Gaps = 1/65 1%
Query  20   DAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKECTD-EIDKGKRVLIA 78
            D   CPA   D   FL      Y +++A+Y+A P  +E    +K C D ++ +  +    
Sbjct  17   DCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILKNCVDAKMTEEDKENAL 76
Query  79   AVLTKI 84
            +VL KI
Sbjct  77   SVLDKI 82

Sequence Alignment: 6. Allergen Name: Fel d 1 Sequence ID: AAC37318

 Score = 32.0 bits 89,  Expect = 0.003
 Identities = 20/63 31%, Positives = 29/63 46%, Gaps = 0/63 0%
Query  5    VPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKE 64
            V +LL A  L  +  +   CPA   D   FL      Y +++A+Y A P  +E    +K 
Sbjct  6    VLVLLWAALLLIWGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKN 65
Query  65   CTD 67
            C D
Sbjct  66   CVD 68

Sequence Alignment: 7. Allergen Name: Fel d 1 Sequence ID: P30438

 Score = 31.1 bits 86,  Expect = 0.006
 Identities = 24/80 30%, Positives = 37/80 46%, Gaps = 1/80 1%
Query  5    VPLLLVALALGCYEADAAACPAFVLDSVGFLFDPKPVYRQKLAKYDAPPEAVEAKLQVKE 64
            V +LL A  L     +   CPA   D   FL      Y +++A+Y A P  +E    +K 
Sbjct  6    VLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKN 65
Query  65   CTD-EIDKGKRVLIAAVLTKI 84
            C D ++ +  +    +VL KI
Sbjct  66   CVDAKMTEEDKENALSVLDKI 86

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.