The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKG
CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAG
GKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCG
IGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA34256 Tri a 18 212 1635 243.5 3.5e-66
AAA34258 Tri a 18 213 1556 232.3 8.5e-63
AAA34257 Tri a 18 186 1420 212.9 5.1e-57
P02877 Hev b 6.01 204 233 44.3 3.3e-06
Exo m 1.0101 40 210
P0DKH8 Fag e 4.0102 40 210 40.3 9.9e-06
Q42428 Cas s 5 316 223 43.0 1.2e-05
CAC42881 Hev b 11.0101 295 210 41.1 4.2e-05
Q8VXF1 Mus a 2.0101 318 210 41.2 4.4e-05
CAD24068 Hev b 11.0102 295 206 40.6 6.2e-05
CAB01591 Pers a 1 326 206 40.6 6.7e-05
P29022 Zea m 8.0101 280 189 38.1 0.00032
P81729 Bra r 2 91 163 34.0 0.0018
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 243.5 bits 1635,  Expect = 4e-66
 Identities = 212/212 100%, Positives = 212/212 100%, Gaps = 0/212 0%
Query  1    MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKG 60
            MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKG
Sbjct  1    MKMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKG 60
Query  61   CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAG 120
            CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAG
Sbjct  61   CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAG 120
Query  121  GKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCG 180
            GKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCG
Sbjct  121  GKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCG 180
Query  181  IGPGYCGAGCQSGGCDGVFAEAITANSTLLQE 212
            IGPGYCGAGCQSGGCDGVFAEAITANSTLLQE
Sbjct  181  IGPGYCGAGCQSGGCDGVFAEAITANSTLLQE 212

Sequence Alignment: 2. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 232.3 bits 1556,  Expect = 9e-63
 Identities = 200/211 94%, Positives = 203/211 96%, Gaps = 0/211 0%
Query  2    KMMSTRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC 61
            KMMST AL LGAA  LAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC
Sbjct  3    KMMSTMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGC 62
Query  62   QNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGG 121
            QNGACWTSKRCGSQAGGATC NN+CCSQYG+CGFGAEYCGAGCQGGPCRADIKCGSQ+GG
Sbjct  63   QNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGG 122
Query  122  KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI 181
            KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI
Sbjct  123  KLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGI 182
Query  182  GPGYCGAGCQSGGCDGVFAEAITANSTLLQE 212
            GPGYCGAGCQSGGCD VFA AITANSTLL E
Sbjct  183  GPGYCGAGCQSGGCDAVFAGAITANSTLLAE 213

Sequence Alignment: 3. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 212.9 bits 1420,  Expect = 5e-57
 Identities = 175/186 94%, Positives = 179/186 96%, Gaps = 0/186 0%
Query  27   QRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGATCTNNQC 86
            QRCGEQGS MECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGG TC NN+C
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHC 60
Query  87   CSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGG 146
            CSQYG+CGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWG+CGLGSEFCG G
Sbjct  61   CSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEG 120
Query  147  CQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAITAN 206
            CQ+GACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAI  N
Sbjct  121  CQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATN 180
Query  207  STLLQE 212
            STLL E
Sbjct  181  STLLAE 186

Sequence Alignment: 4. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 44.3 bits 233,  Expect = 3e-06
 Identities = 35/61 57%, Positives = 41/61 67%, Gaps = 7/61 11%
Query  104  CQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGG--GCQSGACSTDKPCGKD 161
            C  G   A+ +CG QAGGKLCPNNLCCSQWG+CG   E+C     CQS  C   K  G+ 
Sbjct  10   CLTGVAIAE-QCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSN-C---KDSGEG 64
Query  162  AGGRVCTN 169
             GG   +N
Sbjct  65   VGGGSASN 72

Sequence Alignment: 5. Allergen Name: Exo Sequence ID:

 Score = 40.3 bits 210,  Expect = 1e-05
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 152
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 6. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 40.3 bits 210,  Expect = 1e-05
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 152
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39

Sequence Alignment: 7. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 43.0 bits 223,  Expect = 1e-05
 Identities = 61/160 38%, Positives = 81/160 50%, Gaps = 32/160 20%
Query  17   LAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQA 76
            LAF   T+ A++CG Q     C NNLCCSQ+G+CG   +YCG GCQ+       +C S  
Sbjct  10   LAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQS-------QCSSPT 61
Query  77   GGATCTNNQCCSQYGYCGFGAEYCGAGC-QGGPCRADIKCGSQAGGKLCPNNLCCSQWGF 135
               T T++   S  G    G+    +   Q    R D +C S   G    N +  +   F
Sbjct  62   ---TTTSSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSN--GFYTYNAFIAAARSF 116
Query  136  CGLGS---------EFCGGGCQSGACSTD----KPCGKDAGGR--VCTNN---YCCSKWG 177
             G+G+         E+     Q+   +T      P G  A G   V  NN   YC SK  
Sbjct  117  NGFGTTGDVTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMENNKQTYCTSKSW 176
Query  178  SCGIGPGYCGAG 189
             C  G  Y G G
Sbjct  177  PCVFGKQYYGRG 188

Sequence Alignment: 8. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 41.1 bits 210,  Expect = 4e-05
 Identities = 28/48 58%, Positives = 33/48 68%, Gaps = 3/48 6%
Query  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGG 164
            +CG QAGG LCP  LCCSQ+G+C    E+CG GCQS  C  D   G + GG
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGGGGEDGG 49

Sequence Alignment: 9. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 41.2 bits 210,  Expect = 4e-05
 Identities = 46/128 35%, Positives = 57/128 44%, Gaps = 16/128 12%
Query  69   SKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQ---------GGPCRADIKCGSQA 119
            +++CG QAGGA C    CCSQYG+CG    YCG GCQ         GG   A I   S  
Sbjct  19   AEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQCGGSGGSGGGSVASIISSSLF 78
Query  120  GGKLCP-NNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKD---AGGRVCTNNYCCSK 175
               L   N+  C   GF    +        SG  +T     K    A     T++     
Sbjct  79   EQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDAKKKREIAAFLAQTSHETTGG 138
Query  176  WGSCGIGP---GYCGAGCQSGGCD 196
            W +   GP   GYC    Q+   D
Sbjct  139  WATAPDGPYAWGYCFVQEQNPSSD 162

Sequence Alignment: 10. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 40.6 bits 206,  Expect = 6e-05
 Identities = 27/47 57%, Positives = 32/47 68%, Gaps = 3/47 6%
Query  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAG 163
            +CG QAGG LCP  LCCSQ+G+C    E+CG GCQS  C  D   G + G
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQS-QC--DGGVGGEGG 48

Sequence Alignment: 11. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 40.6 bits 206,  Expect = 7e-05
 Identities = 30/55 54%, Positives = 36/55 65%, Gaps = 4/55 7%
Query  103  GCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACS--TDKPCG 159
            G   G   A+ +CG QAGG LCP  LCCSQ+G+CG  S++CG  CQS  C   T  P G
Sbjct  17   GLLAGEAFAE-QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-QCGGVTPSPGG 73

Sequence Alignment: 12. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 38.1 bits 189,  Expect = 0.0003
 Identities = 39/92 42%, Positives = 51/92 55%, Gaps = 13/92 14%
Query  7    RALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGAC 66
            R LALG  A+L  AA  A AQ CG       C  N+CCS++GYCG    YCG GCQ+G C
Sbjct  6    RILALGLLALLCAAAGPAAAQNCG-------CQPNFCCSKFGYCGTTDAYCGDGCQSGPC 58
Query  67   WTSKRCGSQAGGATCTNN-----QCCSQYGYCGFGAEYCGAGCQG 106
             +    G   GG    +         +   + G   +  G+GC+G
Sbjct  59   RSGGGGGGGGGGGGGGSGGANVANVVTDAFFNGIKNQ-AGSGCEG 102

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 34.0 bits 163,  Expect = 0.002
 Identities = 26/56 46%, Positives = 30/56 53%, Gaps = 5/56 8%
Query  75   QAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIK--CGSQAGGKLCPNNLCCSQ 132
            QAGG TC  N CCSQYGYCG  A+YC        C+A       +Q    L   +  CS 
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPD---NNCQATYHYYNPAQNNWDLRAVSAYCST 57
Query  133  W 133
            W
Sbjct  58   W 58

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.