The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGE
RYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRV
MTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVY
KLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA
Sequence Info Allergen Name Length Opt Bits Score E Value
P20347 Sola t 3.0102 222 1483 344.8 1.3e-96
O24383 Sola t 3.0101 186 1133 265.1 1e-72
P30941 Sola t 4 221 267 67.6 3.5e-13
CAA45723 Sola t 4 217 206 53.7 5.2e-09
P16348 Sola t 2 188 192 50.6 3.9e-08
AAB23464 Gly m TI 216 132 36.9 0.00062
CAA45777 Gly m TI 217 132 36.9 0.00062
AAB23482 Gly m TI 203 122 34.6 0.0028
AAB23483 Gly m TI 204 118 33.7 0.0052
P01071 Gly m TI 181 116 33.3 0.0061
CAA45778 Gly m TI 217 115 33.0 0.0091
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 344.8 bits 1483,  Expect = 1e-96
 Identities = 222/222 100%, Positives = 222/222 100%, Gaps = 0/222 0%
Query  1    MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGE 60
            MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGE
Sbjct  1    MKSINILSFLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGE 60
Query  61   RYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRV 120
            RYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRV
Sbjct  61   RYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRV 120
Query  121  MTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVY 180
            MTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVY
Sbjct  121  MTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGKVGNENDIFKIMKTDLVTPGGSKYVY 180
Query  181  KLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA 222
            KLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA
Sbjct  181  KLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFIPFVFIKA 222

Sequence Alignment: 2. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 265.1 bits 1133,  Expect = 1e-72
 Identities = 168/186 90%, Positives = 175/186 94%, Gaps = 1/186 0%
Query  36   TCHDDDNLVLPEVYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIP 95
            TCHDDDNLVLPEVYDQDGNPLRIGERYII NPLLGAGAVYL NIGNLQCPNAVLQHMSIP
Sbjct  1    TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP 60
Query  96   QFLGEGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGK 155
            QFLG+GTPVVF+RKSESDYGDVVR+MT VYIKFFVKTTKLCVD+TVWKVN+EQLVVTGG 
Sbjct  61   QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN 120
Query  156  VGNENDIFKIMKTDLVTPGGSKYVYKLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFI 215
            VGNENDIFKI KTDLV  G  K VYKLLHCPSHL CKNIG NFKNGYPRLVTV+D+KDFI
Sbjct  121  VGNENDIFKIKKTDLVIRG-MKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFI 179
Query  216  PFVFIKA 222
            PFVFIKA
Sbjct  180  PFVFIKA 186

Sequence Alignment: 3. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 67.6 bits 267,  Expect = 3e-13
 Identities = 75/191 39%, Positives = 110/191 57%, Gaps = 40/191 20%
Query  9    FLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPL 68
            FLL    + +V F+ +FTS+NPI LP+          P V D  G  L     Y I + +
Sbjct  5    FLLCLCLVPIVVFSSTFTSKNPINLPSD-------ATP-VLDVAGKELDSRLSYRIISTF 56
Query  69   LGA--GAVYLYNIGNLQ--CPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVV 124
             GA  G VYL    N    C N ++++ S       GTPV F+  S S +G  +    ++
Sbjct  57   WGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTPVRFI-GSSSHFGQGIFENELL 113
Query  125  YIKFFVKTTKLCVDQTVWKVND------EQLVVTGGKVGN-ENDIFKIMKTDLVTPGGSK 177
             I+F + T+KLCV  T+WKV D        L+ TGG +G  ++  FKI+K+       S+
Sbjct  114  NIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKS-------SQ 166
Query  178  YVYKLLHCP--SHLGCK---------NIGGNFKNGYPRLVTVDDDKDFIPF 217
            + Y LL+CP  S + C           +G   +NG  RL  V D+   + F
Sbjct  167  FGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSF 217

Sequence Alignment: 4. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 53.7 bits 206,  Expect = 5e-09
 Identities = 74/187 39%, Positives = 108/187 57%, Gaps = 44/187 23%
Query  9    FLLLSSTLSLVAFARSFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPL 68
            FLL    + +V F+ +FTS+NPI LP+          P V D  G  L     Y I + +
Sbjct  5    FLLCLCLVPIVVFSSTFTSKNPINLPSD-------ATP-VLDVAGKELDSRLSYRIISTF 56
Query  69   LGA--GAVYLYNIGNLQ--CPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVV 124
             GA  G VYL    N    C N ++++ S       GTPV F     S +G  +    ++
Sbjct  57   WGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTPVRF-----SHFGQGIFENELL 109
Query  125  YIKFFVKTTKLCVDQTVWKVND------EQLVVTGGKVGN-ENDIFKIMKTDLVTPGGSK 177
             I+F + T+KLCV  T+WKV D        L+ TGG +G  ++  FKI+K+       S+
Sbjct  110  NIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKS-------SQ 162
Query  178  YVYKLLHCP--SHLGCK---------NIGGNFKNGYPRLVTVDDDKDFIPF 217
            + Y LL+CP  S + C           +G   +NG  RL  V D+   + F
Sbjct  163  FGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSF 213

Sequence Alignment: 5. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 50.6 bits 192,  Expect = 4e-08
 Identities = 59/153 38%, Positives = 86/153 56%, Gaps = 37/153 24%
Query  45   LPE-VYDQDGNPLRIGERYIINNPLLGA--GAVYLYNIGNLQ--CPNAVLQHMSIPQFLG 99
            LP+ V D +G  L     Y I +   GA  G VYL    N    CP+ V+++ S      
Sbjct  4    LPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNS--DVGP 61
Query  100  EGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVND------EQLVVTG 153
             GTPV F+  S   + D      ++ I+F + T KLCV  T+WKV +        L+ TG
Sbjct  62   SGTPVRFIPLSGGIFED-----QLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETG 116
Query  154  GKVGN-ENDIFKIMKTDLVTPGGSKYVYKLLHCP-----------SHLGCKNIGGNFKNG 201
            G +G  ++  FKI+K        S + Y LL+CP               C  +G   +NG
Sbjct  117  GTIGQADSSYFKIVKL-------SNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNG 169
Query  202  YPRLVTVDDD 211
              RL  V+++
Sbjct  170  KRRLALVNEN 179

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 36.9 bits 132,  Expect = 0.0006
 Identities = 44/161 27%, Positives = 72/161 44%, Gaps = 14/161 8%
Query  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFV 107
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L +G   +  
Sbjct  27   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 83
Query  108  RKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNENDIFK-I 165
                  +      +++ +  F V    LCV   T W V ++       K+G   D     
Sbjct  84   SPYRIRFIAEGHPLSLKFDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGW 141
Query  166  MKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFK--NGYPRLVTVDDDKDFI 215
             + + V+       YKL+ CP +     C +IG +    +G  RLV V  +K ++
Sbjct  142  FRLERVSDDEFNN-YKLVFCPQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 194

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 36.9 bits 132,  Expect = 0.0006
 Identities = 44/161 27%, Positives = 72/161 44%, Gaps = 14/161 8%
Query  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVFV 107
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L +G   +  
Sbjct  28   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 84
Query  108  RKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNENDIFK-I 165
                  +      +++ +  F V    LCV   T W V ++       K+G   D     
Sbjct  85   SPYRIRFIAEGHPLSLKFDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGW 142
Query  166  MKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFK--NGYPRLVTVDDDKDFI 215
             + + V+       YKL+ CP +     C +IG +    +G  RLV V  +K ++
Sbjct  143  FRLERVSDDEFNN-YKLVFCPQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 195

Sequence Alignment: 8. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 34.6 bits 122,  Expect = 0.003
 Identities = 42/162 25%, Positives = 74/162 45%, Gaps = 14/162 8%
Query  48   VYDQDGNPLRIGERYIINNPLLG-AGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVF 106
            V D D +PL+ G  Y +   + G  G + + + G   CP  V+Q    P  L +G  +VF
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDSTGKEICPLTVVQS---PNELDKGIGLVF 84
Query  107  VRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQ-TVWKVNDEQLVVTGGKVGNENDIFKI 165
                 + +      +++ +  F V T  LC    T W +  E+  +   K+   + +   
Sbjct  85   TSPLHALFIAERYPLSIKFGSFAVIT--LCAGMPTEWAIV-EREGLQAVKLAARDTVDGW 141
Query  166  MKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFKN-GYPRLVTVDDDKDFIPF 217
               + V+   +   YKL+ CP +     C++IG    + G  RLV   +    + F
Sbjct  142  FNIERVSREYND--YKLVFCPQQAEDNKCEDIGIQIDDDGIRRLVLSKNKPLVVQF 195

Sequence Alignment: 9. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 33.7 bits 118,  Expect = 0.005
 Identities = 45/161 27%, Positives = 73/161 45%, Gaps = 17/161 10%
Query  48   VYDQDGNPLRIGERYIINNPLLG-AGAVYLYNIGNLQCPNAVLQHMSIPQFLGEGTPVVF 106
            V D D +PL+ G  Y +   + G +G +   + G   CP  V+Q    P    +G  +VF
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNSTGKEICPLTVVQS---PNKHNKGIGLVF 84
Query  107  VRKSESDYGDVVRVMTVVYIKFFVKTTKLC-VDQTVWKVNDEQ--LVVTGGKVGNENDIF 163
                 + +      +++ +  F V    LC V  T W + + +    VT       +  F
Sbjct  85   KSPLHALFIAERYPLSIKFDSFAV--IPLCGVMPTKWAIVEREGLQAVTLAARDTVDGWF 142
Query  164  KIMKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFKN-GYPRLVTVDDDKDFIPF 217
             I +   V+   + Y YKL+ CP       C++IG    N G  RLV   +    + F
Sbjct  143  NIER---VSREYNDY-YKLVFCPQEAEDNKCEDIGIQIDNDGIRRLVLSKNKPLVVEF 196

Sequence Alignment: 10. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 33.3 bits 116,  Expect = 0.006
 Identities = 47/157 29%, Positives = 74/157 47%, Gaps = 22/157 14%
Query  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMS-IPQFLGEGTPVVF 106
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  + + + +G      F
Sbjct  3    VLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPF 62
Query  107  VRKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNENDI--- 162
             R      G+ +R+    +  F V    LCV   T W V ++       K+G   D    
Sbjct  63   -RIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDG 116
Query  163  -FKIMKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFK--NGYPRLVTVDDDKDFI 215
             F+I +            YKL+ C  +     C +IG +    +G  RLV V  +K ++
Sbjct  117  WFRIERVS----DDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 170

Sequence Alignment: 11. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 33.0 bits 115,  Expect = 0.009
 Identities = 47/157 29%, Positives = 74/157 47%, Gaps = 22/157 14%
Query  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMS-IPQFLGEGTPVVF 106
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  + + + +G      F
Sbjct  28   VLDNEGNPLDSGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPF 87
Query  107  VRKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNENDI--- 162
             R      G+ +R+    +  F V    LCV   T W V ++       K+G   D    
Sbjct  88   -RIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDG 141
Query  163  -FKIMKTDLVTPGGSKYVYKLLHCPSHL---GCKNIGGNFK--NGYPRLVTVDDDKDFI 215
             F+I +            YKL+ C  +     C +IG +    +G  RLV V  +K ++
Sbjct  142  WFRIERVS----DDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 195

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.