The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV
TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW
YITVMPCSIGTKFDPISRNCVLDN
Sequence Info Allergen Name Length Opt Bits Score E Value
Q17282 Blo t 12 144 992 233.4 1.9e-63
Q4JK69 Der p 15.0101 532 148 40.7 7.1e-05
AAD52672 Der f 15.0101 555 148 40.7 7.4e-05
Q4JK70 Der p 15.0102 558 142 39.3 0.00019
Q4JK71 Der p 18.0101 462 119 34.1 0.006
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 12 Sequence ID: Q17282

 Score = 233.4 bits 992,  Expect = 2e-63
 Identities = 144/144 100%, Positives = 144/144 100%, Gaps = 0/144 0%
Query  1    MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV 60
            MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV
Sbjct  1    MKSVLIFLVAIALFSANIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVV 60
Query  61   TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW 120
            TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW
Sbjct  61   TTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLW 120
Query  121  YITVMPCSIGTKFDPISRNCVLDN 144
            YITVMPCSIGTKFDPISRNCVLDN
Sbjct  121  YITVMPCSIGTKFDPISRNCVLDN 144

Sequence Alignment: 2. Allergen Name: Der p 15.0101 Sequence ID: Q4JK69

 Score = 40.7 bits 148,  Expect = 7e-05
 Identities = 35/127 27%, Positives = 55/127 43%, Gaps = 7/127 5%
Query  17   NIVSADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHH-HEEVVTTQTPH--HEEKTTT 73
            N+++ DE+ +      P      PTT  T   TT T         TT TP       TTT
Sbjct  399  NMINGDEKNSYECLLGPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTTPTPTTPSTPSTTT 458
Query  74   EETHHSDDLIVHEGGKTY---HVV-CHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSI 129
                 +D         TY   H++ C++EG +      +KY++C      W++ +MPC  
Sbjct  459  PTPTTTDSTSETPKYTTYVDGHLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCPP 518
Query  130  GTKFDPISRNCVLD 143
            GT +      C+ +
Sbjct  519  GTIWCQEKLTCITE 532

Sequence Alignment: 3. Allergen Name: Der f 15.0101 Sequence ID: AAD52672

 Score = 40.7 bits 148,  Expect = 7e-05
 Identities = 35/116 30%, Positives = 49/116 42%, Gaps = 7/116 6%
Query  20   SADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHS 79
            S    TT    T P       T   T   TT T        TT TP     TTTE T  +
Sbjct  437  SPTTPTTTPSPTTPTTTPSPTTPTTTPSPTTPTPTTPTPAPTTSTP---SPTTTEHTSET 493
Query  80   DDLIVHEGGKTYHVV-CHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISR 138
                 +  G   H++ C++EG I      +KY++C      W++ +MPC  GT +     
Sbjct  494  PKYTTYVDG---HLIKCYKEGDIPHPTNIHKYLVCEFVNGGWWVHIMPCPPGTIWCQEKL 550
Query  139  NCV 141
             C+
Sbjct  551  TCI 553

Sequence Alignment: 4. Allergen Name: Der p 15.0102 Sequence ID: Q4JK70

 Score = 39.3 bits 142,  Expect = 0.0002
 Identities = 30/106 28%, Positives = 49/106 46%, Gaps = 8/106 7%
Query  31   TEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKT 90
            + P      PTT  T   TT T        +T TP     TTT+ T  +     +  G  
Sbjct  452  STPSTTTPTPTTPSTPSTTTPTPTT-PSTTSTTTP---TPTTTDSTSETPKYTTYVDG-- 505
Query  91   YHVV-CHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLD 143
             H++ C++EG +      +KY++C      W++ +MPC  GT +      C+ +
Sbjct  506  -HLIKCYKEGDLPHPTNIHKYLVCEYVNGGWWVHIMPCPPGTIWCQEKLTCITE 558

Sequence Alignment: 5. Allergen Name: Der p 18.0101 Sequence ID: Q4JK71

 Score = 34.1 bits 119,  Expect = 0.006
 Identities = 29/72 40%, Positives = 36/72 50%, Gaps = 14/72 19%
Query  57   EEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKS 116
            E  V T TP       T  T H  D+    G   +H  CH+EG    +  C KY  C K 
Sbjct  382  EPTVVTVTP------VTHTTEHVTDI---PG--VFH--CHQEGFFRDKTYCAKYYECKKG 428
Query  117  GSLWYITVMPCSIGTK-FDPISRNCV 141
                  TV  C   ++ FD +SR CV
Sbjct  429  DFGLEQTVHHCPNHSQAFDEVSRTCV 454

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.