The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTALVFAAVVAFVAARFPDHKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGI
PMTSKQTSATTVPPSGEAVHGVLQEGHARPRGEPFSVNYEKHREQAIMLYDLLYFANDYD
TFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKY
WMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHN
IDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRP
SNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNM
DSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPSLEHPETVLRDPVFYQLWKRVDHLFQK
YKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQLAV
RLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAG
KTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKK
GGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDF
YTPNMYFKDVIIFHKKYDEVGVQGH
Sequence Info Allergen Name Length Opt Bits Score E Value
Q25641 Per a 3.0101 685 4755 1090.0 0
AAB09632 Per a 3.0201 631 3131 719.8 1.4e-208
D0VNY7 Bla g 3.0101 657 2781 640.1 1.5e-184
AAB62731 Per a 3.0202 470 2419 557.6 7.3e-160
AAB63595 Per a 3.0203 393 2007 463.8 1.1e-131
G1AP69 Pen m 7.0101 683 1250 291.1 1.8e-79
AEB77775 Pen m 7.0102 683 1250 291.1 1.8e-79
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 3.0101 Sequence ID: Q25641

 Score = 1090.0 bits 4755,  Expect = 0
 Identities = 685/685 100%, Positives = 685/685 100%, Gaps = 0/685 0%
Query  1    MKTALVFAAVVAFVAARFPDHKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGI 60
            MKTALVFAAVVAFVAARFPDHKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGI
Sbjct  1    MKTALVFAAVVAFVAARFPDHKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGI 60
Query  61   PMTSKQTSATTVPPSGEAVHGVLQEGHARPRGEPFSVNYEKHREQAIMLYDLLYFANDYD 120
            PMTSKQTSATTVPPSGEAVHGVLQEGHARPRGEPFSVNYEKHREQAIMLYDLLYFANDYD
Sbjct  61   PMTSKQTSATTVPPSGEAVHGVLQEGHARPRGEPFSVNYEKHREQAIMLYDLLYFANDYD 120
Query  121  TFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKY 180
            TFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKY
Sbjct  121  TFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKY 180
Query  181  WMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHN 240
            WMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHN
Sbjct  181  WMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHN 240
Query  241  IDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRP 300
            IDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRP
Sbjct  241  IDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRP 300
Query  301  SNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNM 360
            SNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNM
Sbjct  301  SNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNM 360
Query  361  DSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPSLEHPETVLRDPVFYQLWKRVDHLFQK 420
            DSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPSLEHPETVLRDPVFYQLWKRVDHLFQK
Sbjct  361  DSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPSLEHPETVLRDPVFYQLWKRVDHLFQK 420
Query  421  YKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQLAV 480
            YKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQLAV
Sbjct  421  YKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQLAV 480
Query  481  RLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAG 540
            RLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAG
Sbjct  481  RLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAG 540
Query  541  KTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKK 600
            KTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKK
Sbjct  541  KTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKK 600
Query  601  GGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDF 660
            GGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDF
Sbjct  601  GGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDF 660
Query  661  YTPNMYFKDVIIFHKKYDEVGVQGH 685
            YTPNMYFKDVIIFHKKYDEVGVQGH
Sbjct  661  YTPNMYFKDVIIFHKKYDEVGVQGH 685

Sequence Alignment: 2. Allergen Name: Per a 3.0201 Sequence ID: AAB09632

 Score = 719.8 bits 3131,  Expect = 1e-208
 Identities = 433/591 73%, Positives = 507/591 85%, Gaps = 2/591 0%
Query  90   PRGEPFSVNYEKHREQAIMLYDLLYFANDYDTFYKTACWARDRVNEGMFMYSFSIAVFHR 149
            PRGEPFSV YEKHREQAI L++L++ ANDYDTFYKTACWARDRVNEGMFMY++++A FHR
Sbjct  34   PRGEPFSVYYEKHREQAIKLFELFFAANDYDTFYKTACWARDRVNEGMFMYALTVAAFHR 93
Query  150  DDMQGVMLPPPYEVYPYLFVDHDVIHMAQKYWMKNAGSGEHHSHVIPVNFTLRTQDHLLA 209
            +D + ++LPPPYEV PYLFV+ DVI+ A KYW K +G+ +H  HVIPVNFT R+Q+ L+A
Sbjct  94   EDTKDLVLPPPYEVNPYLFVEDDVIQQAYKYWTKESGTDKHVEHVIPVNFTARSQEDLVA 153
Query  210  YFTSDVNLNAFNTYYRYYYPSWYNTTLYGHNIDRRGEQFYYTYKQIYARYFLERLSNDLP 269
            YF  DV+LNAFN Y+RY YPSW+NTTLYG + DRRGEQFYYTY QIYARYFLERLSN LP
Sbjct  154  YFREDVDLNAFNMYFRYIYPSWFNTTLYGKSFDRRGEQFYYTYHQIYARYFLERLSNSLP 213
Query  270  DVYPFYYSKPVKSAYNPNLRYHNGEEMPVRPSNMYVTNFDLYYIADIKNYEKRVEDAIDF 329
            DV PF YSKP+K+ YNP+LRYHNGEEMP RPSNMY TNFDL+Y++DIKNYE+RVE AIDF
Sbjct  214  DVKPFQYSKPLKTGYNPHLRYHNGEEMPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDF 273
Query  330  GYAFDEHMKPHSLYHDVHGMEYLADMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKM 389
            GYAFDEH  P+SLYHD HGM+YL  MIEG  +SP+ YFYGS++H Y  ++GH+VDPYHK 
Sbjct  274  GYAFDEHRTPYSLYHDQHGMDYLGQMIEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKN 333
Query  390  GLAPS-LEHPETVLRDPVFYQLWKRVDHLFQKYKNRLPRYTHDELAFEGVKVENVDVGKL 448
            GLAPS LEHP+T LRDP FYQLWKR+DH+ QKYKNRLPRYT+DEL+F GVK+ENVDVGKL
Sbjct  334  GLAPSALEHPQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKL 393
Query  449  YTYFEQYDMSLDMAVYVNNVDQISNVDVQLA-VRLNHKPFTYNIEVSSDKAQDVYVAVFL 507
            YTYFE+++ SL  A+Y+  ++      ++    RLNHKPFTYNIEVSSDKAQDVYV +FL
Sbjct  394  YTYFEHFEHSLGNAMYLGKLEDYMKASIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFL 453
Query  508  GPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKK 567
            GPKYD LG E +L++RRHYFVEMDRF + V AGKTVIER SHDS+II+   DSYR ++KK
Sbjct  454  GPKYDSLGHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKK 513
Query  568  VQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNY 627
            V +A + K QYY+DK H YCGYPENLL+PKGKKGGQ +TFYVIVTPYVKQDEHDFEPY+Y
Sbjct  514  VSDALQEKDQYYIDKSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHY 573
Query  628  KAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDFYTPNMYFKDVIIFHKKYDEV 680
            KAFSYCGVG  RKYPD+KPLG+PFDRKI+  DFYTPNMYFKDV+IFHKKYDEV
Sbjct  574  KAFSYCGVGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEV 626

Sequence Alignment: 3. Allergen Name: Bla g 3.0101 Sequence ID: D0VNY7

 Score = 640.1 bits 2781,  Expect = 2e-184
 Identities = 396/649 61%, Positives = 500/649 77%, Gaps = 7/649 1%
Query  28   ADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGIPMTSKQTSATTVPPSGEAVHGVLQEGH 87
            ADK FL KQ DVLRL HR+HQH+I+ +QV VG     +        P        L +  
Sbjct  3    ADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYKKD 62
Query  88   ARPRGEPFSVNYEKHREQAIMLYDLLYFANDYDTFYKTACWARDRVNEGMFMYSFSIAVF 147
               RGEPFS  Y KHREQAIML++L+Y+ANDYDTFYKTACWARDRVNEGMF+YSF+IA+ 
Sbjct  63   PVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIAIM 122
Query  148  HRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKYWMKNAGS-GEHHSHVIPVNFTLRTQDH 206
            HR+DMQ +++P  YE+YP+LFV++DVI+ A  Y MK +G   E H+HVIPVNFTLR Q++
Sbjct  123  HREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQEQ 182
Query  207  LLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHNIDRRGEQFYYTYKQIYARYFLERLSN 266
            LL+YFT DV LNAFNTY+RY YP+W+N T Y +++ R GEQFYY  +Q++ARY LER SN
Sbjct  183  LLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERYSN 242
Query  267  DLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRPSNMYVTNFDLYYIADIKNYEKRVEDA 326
            D+P++ PF Y+KP K+ YNP LRY NG+E+P RP+ M   +FDL Y++DIKNYEKRV DA
Sbjct  243  DMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVADA 302
Query  327  IDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPY 386
            +DFGY F + M  HSLY++  G+E+L  ++EGN   P+FY  G I+HMY S++GHI DP+
Sbjct  303  VDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFY--GHIFHMYRSLLGHITDPF 360
Query  387  HKMGLAPS-LEHPETVLRDPVFYQLWKRVDHLFQKYKNRLPRYTHDELAFEGVKVENVDV 445
            HK G+APS LEHPET LRDP FYQ+WKRV H F K++ + P YT +ELAF+GVK++NVDV
Sbjct  361  HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV 420
Query  446  GKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQL-AVRLNHKPFTYNIEVSSDKAQDVYVA 504
            GKLYTYFE Y+M L  AV V  ++ + NVD++    RLNHKPFTYN+EV+S+K   VYV 
Sbjct  421  GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR 480
Query  505  VFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTF 564
            VFLGPKY+Y G EYDLN+RR+YFVE+DRFPY++  GK  I+RNSHDS+++A E+D+Y+ +
Sbjct  481  VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL 540
Query  565  YKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEP 624
            YKKV EAYEGK+ Y  +K   YCG PE+LLIPKGKKGGQA+T YVIVTPY K  E   E 
Sbjct  541  YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEK--EE 598
Query  625  YNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDFYTPNMYFKDVIIFHKKYDEV 680
            +++KA+SYCGVG      D KPLG+PFDR I+S DF TPNM+ KDV IFHKKY+EV
Sbjct  599  HHFKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEV 654

Sequence Alignment: 4. Allergen Name: Per a 3.0202 Sequence ID: AAB62731

 Score = 557.6 bits 2419,  Expect = 7e-160
 Identities = 339/463 73%, Positives = 393/463 84%, Gaps = 3/463 0%
Query  217  LNAFNTYYRYYYPSWYNTTLYGHNIDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYY 276
            LNAFN Y+RY YP+W+NTTLYG   DRRGEQFYYTY QIYARYFLERLSN LPDV PF Y
Sbjct  1    LNAFNMYFRYIYPTWFNTTLYGKTFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQY 60
Query  277  SKPVKSAYNPNLRYHNGEEMPVRPSNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEH 336
            SKP+K+ YNP+LRY+NGEEMP RPSNMY TN DL+Y++DIKNYE RVE AIDF  AFDEH
Sbjct  61   SKPLKTGYNPHLRYQNGEEMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFD-AFDEH 119
Query  337  MKPHSLYHDVHGMEYLADMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPS-L 395
              P+SLYHD HGM+YL  MIEG  +SP  YFYGSI+H Y  ++GH+VDPYHK GLAPS L
Sbjct  120  RTPYSLYHDQHGMDYLGQMIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSAL 179
Query  396  EHPETVLRDPVFYQLWKRVDHLFQKYKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQY 455
            EH +T LRDP FYQLWKR+DH+ QKYKNRLPRYT+DEL+F GVK+ENVDVGKLYTYFE++
Sbjct  180  EHHQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHF 239
Query  456  DMSLDMAVYVNNVDQISNVDVQLA-VRLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYL 514
            + SL  A+Y+  ++ +   +++    RLNHKPFTYNIEVSSDKAQDVYV +FLGPKYD L
Sbjct  240  EHSLGNAMYLGKLEDVLKANIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSL 299
Query  515  GREYDLNDRRHYFVEMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEG 574
            G E +L++RRHYFVEMDRF + V AGKTVIER SHDS+II+   DSYR ++KKV +A EG
Sbjct  300  GHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALEG 359
Query  575  KSQYYVDKGHNYCGYPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCG 634
            K QYY+D  H YCGYPENLL+PKGKKGGQ +TFYVIVTPYVKQDEHD+E Y+YKAF+YCG
Sbjct  360  KDQYYIDNSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDLESYHYKAFTYCG 419
Query  635  VGSERKYPDNKPLGYPFDRKIYSNDFYTPNMYFKDVIIFHKKYDEV 680
            VG  RKYPD+KPLG+PFDRKI+  DFYTPNMYFKDV+IFHKKYDEV
Sbjct  420  VGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEV 465

Sequence Alignment: 5. Allergen Name: Per a 3.0203 Sequence ID: AAB63595

 Score = 463.8 bits 2007,  Expect = 1e-131
 Identities = 281/386 72%, Positives = 328/386 84%, Gaps = 2/386 0%
Query  295  EMPVRPSNMYVTNFDLYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLAD 354
            EMP RPSNMY TN DL+Y++DIKNYE RVE AIDFGYAFDEH  P+SLYHD HGM+YL  
Sbjct  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
Query  355  MIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPS-LEHPETVLRDPVFYQLWKR 413
            MIEG  +SP  YFYGSI+H Y  ++GH+VDPYHK GLAPS LEH +T LRDP FYQLWKR
Sbjct  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
Query  414  VDHLFQKYKNRLPRYTHDELAFEGVKVENVDVGKLYTYFEQYDMSLDMAVYVNNVDQISN 473
            +DH+ QKYKNRLPRYT+DEL+F GVK+ENVDVGKLYTYFE+++ SL  A+Y+  ++ +  
Sbjct  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
Query  474  VDVQLA-VRLNHKPFTYNIEVSSDKAQDVYVAVFLGPKYDYLGREYDLNDRRHYFVEMDR 532
             +++ +  RLNHKPFTYNIEVSSDKAQDVYV +FLGPKYD LG E +L++RRHYFVEMDR
Sbjct  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
Query  533  FPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCGYPEN 592
            F + V AGKTVIER SHDS+II+   DSYR +YKKV +A E K QYY+DK H YC YPEN
Sbjct  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
Query  593  LLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLGYPFD 652
            LL+PKGKKGGQ +TFYVIVTPYVKQ++HDFEPY+YKAFSYCGVG  RKYPD+KPLG+PFD
Sbjct  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
Query  653  RKIYSNDFYTPNMYFKDVIIFHKKYDEV 680
            RKI+  DFYTPNMYFKDV+IFHKKYDEV
Sbjct  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEV 388

Sequence Alignment: 6. Allergen Name: Pen m 7.0101 Sequence ID: G1AP69

 Score = 291.1 bits 1250,  Expect = 2e-79
 Identities = 232/659 35%, Positives = 379/659 57%, Gaps = 33/659 5%
Query  1    MKTALVFAAVVAFVAARFPD---HKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVE 57
            MK  L+FA V A  AA +P+   + D    AD Q   KQ DV  L+H+++  +I +  ++
Sbjct  6    MKVLLLFALVAA--AAAWPNFGFQSDAGGAADAQ---KQHDVNFLLHKIYG-DIRDSNLK 59
Query  58   VGIPMTSKQTSATTVPPSGEAVHGV---LQEGHARPRGEPFSVNYEKHREQAIMLYDLLY 114
                    + + +     G+AV+ +   L++     +   FS+   ++RE+A+ML+D+L 
Sbjct  60   GKADSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQRHWFSLFNPRQREEALMLFDVLI 119
Query  115  FANDYDTFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVI 174
               D+DTF   A + R  +NEG F+Y++ +AV H    + V+LPP YEV P+LF + +VI
Sbjct  120  HCKDWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPLSEHVVLPPLYEVTPHLFTNSEVI 179
Query  175  HMAQKYWMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNT 234
              A +   +    G+  S       T +  ++ +AYF  D+ +N  +  +   +P W++ 
Sbjct  180  EAAYRA-KQTQKPGKFKSSFTG---TKKNPEQRVAYFGEDIGMNTHHVTWHMEFPFWWDD 235
Query  235  TLYGHNIDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGE 294
              Y H++DR+GE F++ + Q+  R+  ERLSN L  V  +++ KP+   + P+  Y  G 
Sbjct  236  K-YSHHLDRKGENFFWVHHQLTVRFDAERLSNYLDPVDELHWEKPIVQGFAPHTTYKYGG 294
Query  295  EMPVRPSNMYVTNFD-LYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLA 353
            + P RP N+   + D +  I D+   E R+ DAI  GY  D     H    +  G++ L 
Sbjct  295  QFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGN-HIDIMNERGIDVLG 353
Query  354  DMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPS-LEHPETVLRDPVFYQLWK 412
            D+IE ++ SPN  +YG++++  H ++G   DP+ K  L P  LEH ET  RDP F++L K
Sbjct  354  DVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHK 413
Query  413  RVDHLFQKYKNRLPRYTHDELAFEGVKVENVDV-GKLYTYFEQYDMSLDMAVYVNNVDQI 471
             +D++F+++K+ LP YT +EL F GV V+NV + G+L T+FE ++ +L  A  V++ +QI
Sbjct  414  YMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQI 471
Query  472  SNVDVQLAV-RLNHKPFTYNIEVSSDKAQDVY--VAVFLGPKYDYLGREYDLNDRRHYFV 528
             +V++   V RLNHK F   I+VS++K Q+V   V +F  P  D  G E+ +++ R   +
Sbjct  472  PDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAI 531
Query  529  EMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCG 588
            E+D+F   + AG    ER S +S +  P+  S+ T+++K +EA  G      D   +  G
Sbjct  532  ELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTDF-ESATG 590
Query  589  YPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLG 648
             P  +L+PKG + G  + + V VT        D    N + F++   GS  KYPDN+P G
Sbjct  591  IPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVDGLHENTE-FNH--YGSHGKYPDNRPHG 647
Query  649  YPFDRKIYSNDFYT--PNMYFKDVIIF-HKKY 677
            YP+DRK+     +   PN     V +F H +Y
Sbjct  648  YPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

Sequence Alignment: 7. Allergen Name: Pen m 7.0102 Sequence ID: AEB77775

 Score = 291.1 bits 1250,  Expect = 2e-79
 Identities = 232/659 35%, Positives = 379/659 57%, Gaps = 33/659 5%
Query  1    MKTALVFAAVVAFVAARFPD---HKDYKQLADKQFLAKQRDVLRLFHRVHQHNILNDQVE 57
            MK  L+FA V A  AA +P+   + D    AD Q   KQ DV  L+H+++  +I +  ++
Sbjct  6    MKVLLLFALVAA--AAAWPNFGFQSDAGGAADAQ---KQHDVNFLLHKIYG-DIRDSNLK 59
Query  58   VGIPMTSKQTSATTVPPSGEAVHGV---LQEGHARPRGEPFSVNYEKHREQAIMLYDLLY 114
                    + + +     G+AV+ +   L++     +   FS+   ++RE+A+ML+D+L 
Sbjct  60   GKADSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQRHWFSLFNPRQREEALMLFDVLI 119
Query  115  FANDYDTFYKTACWARDRVNEGMFMYSFSIAVFHRDDMQGVMLPPPYEVYPYLFVDHDVI 174
               D+DTF   A + R  +NEG F+Y++ +AV H    + V+LPP YEV P+LF + +VI
Sbjct  120  HCKDWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPLSEHVVLPPLYEVTPHLFTNSEVI 179
Query  175  HMAQKYWMKNAGSGEHHSHVIPVNFTLRTQDHLLAYFTSDVNLNAFNTYYRYYYPSWYNT 234
              A +   +    G+  S       T +  ++ +AYF  D+ +N  +  +   +P W++ 
Sbjct  180  EAAYRA-KQTQKPGKFKSSFTG---TKKNPEQRVAYFGEDIGMNTHHVTWHMEFPFWWDD 235
Query  235  TLYGHNIDRRGEQFYYTYKQIYARYFLERLSNDLPDVYPFYYSKPVKSAYNPNLRYHNGE 294
              Y H++DR+GE F++ + Q+  R+  ERLSN L  V  +++ KP+   + P+  Y  G 
Sbjct  236  K-YSHHLDRKGENFFWVHHQLTVRFDAERLSNYLDPVDELHWEKPIVQGFAPHTTYKYGG 294
Query  295  EMPVRPSNMYVTNFD-LYYIADIKNYEKRVEDAIDFGYAFDEHMKPHSLYHDVHGMEYLA 353
            + P RP N+   + D +  I D+   E R+ DAI  GY  D     H    +  G++ L 
Sbjct  295  QFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGN-HIDIMNERGIDVLG 353
Query  354  DMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKMGLAPS-LEHPETVLRDPVFYQLWK 412
            D+IE ++ SPN  +YG++++  H ++G   DP+ K  L P  LEH ET  RDP F++L K
Sbjct  354  DVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHK 413
Query  413  RVDHLFQKYKNRLPRYTHDELAFEGVKVENVDV-GKLYTYFEQYDMSLDMAVYVNNVDQI 471
             +D++F+++K+ LP YT +EL F GV V+NV + G+L T+FE ++ +L  A  V++ +QI
Sbjct  414  YMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQI 471
Query  472  SNVDVQLAV-RLNHKPFTYNIEVSSDKAQDVY--VAVFLGPKYDYLGREYDLNDRRHYFV 528
             +V++   V RLNHK F   I+VS++K Q+V   V +F  P  D  G E+ +++ R   +
Sbjct  472  PDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAI 531
Query  529  EMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKKVQEAYEGKSQYYVDKGHNYCG 588
            E+D+F   + AG    ER S +S +  P+  S+ T+++K +EA  G      D   +  G
Sbjct  532  ELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTDF-ESATG 590
Query  589  YPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNYKAFSYCGVGSERKYPDNKPLG 648
             P  +L+PKG + G  + + V VT        D    N + F++   GS  KYPDN+P G
Sbjct  591  IPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVDGLHENTE-FNH--YGSHGKYPDNRPHG 647
Query  649  YPFDRKIYSNDFYT--PNMYFKDVIIF-HKKY 677
            YP+DRK+     +   PN     V +F H +Y
Sbjct  648  YPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.