The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF
SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF
SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ
QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC
HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ
QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF
GVGTGVGSY
Sequence Info Allergen Name Length Opt Bits Score E Value
AEH31546 Tri a 36.0101 369 2582 274.4 5.4e-75
CAA31685 Tri a glutenin 307 1548 169.7 1.5e-43
CAA30570 Tri a glutenin 356 1505 165.4 3.5e-42
CAA59340 Tri a glutenin 276 1307 145.3 3e-36
AAA34287 Tri a gliadin 244 1273 141.9 2.9e-35
CAA59339 Tri a glutenin 261 1239 138.4 3.3e-34
CAA44473 Tri a glutenin 285 1166 131.0 6.1e-32
AAA34285 Tri a gliadin 304 1050 119.3 2.2e-28
CAA59338 Tri a glutenin 229 947 108.9 2.3e-25
CAA36063 Tri a glutenin 295 946 108.8 3.2e-25
AAA34286 Tri a gliadin 323 922 106.3 1.9e-24
AAA34289 Tri a gliadin 327 759 89.8 1.8e-19
CAA35238 Tri a gliadin 307 702 84.1 9.1e-18
BAN29066 Tri a 20.0101 279 695 83.3 1.4e-17
AAA34282 Tri a gliadin 297 682 82.0 3.6e-17
AAA34288 Tri a gliadin 251 677 81.5 4.4e-17
BAA11251 Tri a gliadin 279 677 81.5 4.8e-17
AAA34272 Tri a gliadin 302 658 79.6 2e-16
AAA34276 Tri a gliadin 291 655 79.3 2.3e-16
AAA34290 Tri a gliadin 296 654 79.2 2.6e-16
AAA34274 Tri a gliadin 291 649 78.7 3.6e-16
CAA26383 Tri a gliadin 296 644 78.2 5.2e-16
AAA34283 Tri a gliadin 282 627 76.5 1.6e-15
AAA34279 Tri a gliadin 313 611 74.8 5.5e-15
CAA26385 Tri a gliadin 313 609 74.6 6.4e-15
CAA26384 Tri a gliadin 286 606 74.3 7.2e-15
AAA17741 Tri a gliadin 287 604 74.1 8.3e-15
AAA34275 Tri a gliadin 318 602 73.9 1.1e-14
AAA34278 Tri a gliadin 319 601 73.8 1.1e-14
AAA34280 Tri a gliadin 286 598 73.5 1.3e-14
CAA25593 Tri a gliadin 286 595 73.2 1.6e-14
CAA25261 Tri a gliadin 286 595 73.2 1.6e-14
P80198 Hor v 20.0101 289 560 69.7 1.8e-13
P80198 Hor v 21 289 560 69.7 1.8e-13
AAA34281 Tri a gliadin 262 537 67.3 8.4e-13
CAA26847 Tri a glutenin 660 452 58.8 7.9e-10
AAA34284 Tri a gliadin 186 429 56.4 1.2e-09
CAA28208 Tri a gliadin 154 419 55.4 2e-09
CAA59313 Tri a glutenin 72 396 53.0 4.9e-09
CAA31396 Tri a glutenin 648 421 55.7 6.8e-09
P10388 Tri a 26.0101 839 422 55.8 8.2e-09
CAA31395 Tri a glutenin 839 422 55.8 8.2e-09
CAA27052 Tri a glutenin 838 413 54.9 1.5e-08
CAA43361 Tri a glutenin 705 402 53.7 2.8e-08
CAY54134 Tri a 21.0101 281 386 52.1 3.6e-08
AAB02788 Tri a glutenin 815 377 51.2 1.9e-07
CAA43331 Tri a glutenin 830 374 50.9 2.3e-07
Q9S8D7 Tri a glutenin 30 230 36.1 0.00024
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 36.0101 Sequence ID: AEH31546

 Score = 274.4 bits 2582,  Expect = 5e-75
 Identities = 369/369 100%, Positives = 369/369 100%, Gaps = 0/369 0%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF
Sbjct  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF
Sbjct  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
            SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ
Sbjct  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
            QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC
Sbjct  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
            HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ
Sbjct  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
Query  301  QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF 360
            QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF
Sbjct  301  QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF 360
Query  361  GVGTGVGSY 369
            GVGTGVGSY
Sbjct  361  GVGTGVGSY 369

Sequence Alignment: 2. Allergen Name: Tri a glutenin Sequence ID: CAA31685

 Score = 169.7 bits 1548,  Expect = 1e-43
 Identities = 274/307 89%, Positives = 284/307 92%, Gaps = 62/307 20%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFL+FALLA+ ATSAIAQME   IPGLERP QQQPLPPQQT+     QQP+      F
Sbjct  1    MKTFLVFALLAVAATSAIAQMETRCIPGLERPWQQQPLPPQQTFP----QQPL------F 50
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQ   QQQ  P    QQP FSQQQPPF          QQQPPFSQQQP +     P  
Sbjct  51   SQQQ---QQQLFP----QQPSFSQQQPPF---------WQQQPPFSQQQPIL-----P-- 87
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
              QQPPFSQQQQ VLPQQP FSQQQ P +  QQSPF QQQQ                   
Sbjct  88   --QQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQ------------------- 126
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
                  Q+QQLV  QQQIP V+PSILQQLNPCKVFLQQQCSPVAMPQ LARSQMLQQSSC
Sbjct  127  ------QHQQLV--QQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSC 178
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
            HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQ+ QQQPQQLGQCVSQPQ
Sbjct  179  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQ 238
Query  301  QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF 360
            QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALR LPTMC VNVPLYRTTTSVPF
Sbjct  239  QQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPF 298
Query  361  GVGTGVGSY 369
            GVGTGVG+Y
Sbjct  299  GVGTGVGAY 307

Sequence Alignment: 3. Allergen Name: Tri a glutenin Sequence ID: CAA30570

 Score = 165.4 bits 1505,  Expect = 3e-42
 Identities = 267/340 78%, Positives = 287/340 84%, Gaps = 45/340 13%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPI--QQQPQ 58
            MKTFL+FALLA+ A SA+AQ+           SQQQ  PP       QQQQP   QQQ  
Sbjct  1    MKTFLVFALLALAAASAVAQI-----------SQQQQAPP-----FSQQQQPPFSQQQQP 44
Query  59   PFSQQQ--PCSQQQQQP-LSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQ-PPFSQ 114
            PFSQQQ  P SQQQQQP ++QQQQPPFSQQ PP SQQQQ P+SQQQQP FSQQQ PP+SQ
Sbjct  45   PFSQQQQSPFSQQQQQPPFAQQQQPPFSQQ-PPISQQQQPPFSQQQQPQFSQQQQPPYSQ 103
Query  115  QQQPPFSQQQ-PPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQ 173
            QQQPP+SQQQ PPFSQQQQP + QQ     QQ PPF+QQQ    QQQ    QQQPPF QQ
Sbjct  104  QQQPPYSQQQQPPFSQQQQPPFSQQ-----QQQPPFTQQQQQQQQQQPFTQQQQPPFSQQ 158
Query  174  QQPSLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQ 233
               S  QQPPF QQQ+     QQQIP +HPS+LQQLNPCKVFLQQQC PVAM + LARSQ
Sbjct  159  PPISQQQQPPFLQQQRPPFSRQQQIPVIHPSVLQQLNPCKVFLQQQCIPVAMQRCLARSQ 218
Query  234  MLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGS---------IQT 284
            MLQQS CHVMQQQCCQQL QIP+QSR+E+IRAIIYSIILQ+QQQ Q           IQ 
Sbjct  219  MLQQSICHVMQQQCCQQLRQIPEQSRHESIRAIIYSIILQQQQQQQQQQQQQQGQSIIQY 278
Query  285  PQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTM 344
             QQQPQQLGQCVSQP QQ QQQLGQQPQQQQLA       HQIAQLEVMTSIALRTLPTM
Sbjct  279  QQQQPQQLGQCVSQPLQQLQQQLGQQPQQQQLA-------HQIAQLEVMTSIALRTLPTM 331
Query  345  CRVNVPLYRTTTSVPFGVGTGVGSY 369
            C VNVPLY TTTSVP+GVG GVG Y
Sbjct  332  CNVNVPLYETTTSVPLGVGIGVGVY 356

Sequence Alignment: 4. Allergen Name: Tri a glutenin Sequence ID: CAA59340

 Score = 145.3 bits 1307,  Expect = 3e-36
 Identities = 225/270 83%, Positives = 239/270 88%, Gaps = 25/270 9%
Query  25   HIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPCSQQQQQPLSQQQQPPFSQ 84
            HIP LE+PSQQQPLP QQ L +HQQQ PIQQQPQPF QQ PCSQQQQ PLSQQQQPPFSQ
Sbjct  1    HIPSLEKPSQQQPLPLQQILWYHQQQ-PIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQ 59
Query  85   QQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQPVLPQQPSFSQQ 144
            QQPPFSQQ+          P   QQPPFSQQQQP FSQQQ PF QQQQP+L QQP FSQQ
Sbjct  60   QQPPFSQQEL---------PILPQQPPFSQQQQPQFSQQQQPFPQQQQPLLLQQPPFSQQ 110
Query  145  QLPPFSQQQSPFSQQQQIVLQQQPPF--LQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVH 202
            + PPFSQQQ      QQ VL QQPPF   QQQQP LPQQPPFS +QQ  VLPQQQIP+V+
Sbjct  111  R-PPFSQQQ------QQPVLPQQPPFSQQQQQQPILPQQPPFSLHQQP-VLPQQQIPYVQ 162
Query  203  PSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEA 262
            PSILQQLNPCKVFLQQQCSPVAMPQSLARSQML QSSCHVMQQQCCQQLP+IP+QSRY+A
Sbjct  163  PSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCQQLPRIPEQSRYDA 222
Query  263  IRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLGQ----QPQQ 313
            IRAIIYSI+LQEQQ+ QG  Q  QQQPQQ  Q VSQPQQQ Q+QLGQ    QPQQ
Sbjct  223  IRAIIYSIVLQEQQHGQGFNQPQQQQPQQSVQGVSQPQQQ-QKQLGQCSFQQPQQ 276

Sequence Alignment: 5. Allergen Name: Tri a gliadin Sequence ID: AAA34287

 Score = 141.9 bits 1273,  Expect = 3e-35
 Identities = 198/239 82%, Positives = 204/239 85%, Gaps = 6/239 2%
Query  129  QQQQPVLPQQPSFSQQQLPPFSQQ-QSPFSQQQQIVLQQQPPFLQQQQPSL--PQQPPFS 185
            QQ  P+ PQQ SF  Q   PF QQ Q P  Q QQ+V Q   P      PS   P   PF 
Sbjct  2    QQPFPLQPQQ-SFLWQSQQPFLQQPQQPSPQPQQVV-QIISPATPTTIPSAGKPTSAPFP 59
Query  186  QQQQQ-LVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQ 244
            QQQQQ   L QQQIP V+PSILQQLNPCKVFLQQQCSPVAMPQ LARSQMLQQSSCHVMQ
Sbjct  60   QQQQQHQQLAQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQ 119
Query  245  QQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQ 304
            QQCCQQLPQIPQQSRY+AIRAIIYSIILQEQQQVQGSIQ+ QQQPQQLGQCVSQPQQQSQ
Sbjct  120  QQCCQQLPQIPQQSRYQAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQ 179
Query  305  QQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPFGVGT 364
            QQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALR LPTMC VNVPLYRTTTSVPFGVGT
Sbjct  180  QQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGT 239
Query  365  GVGSY 369
            GVG+Y
Sbjct  240  GVGAY 244

Sequence Alignment: 6. Allergen Name: Tri a glutenin Sequence ID: CAA59339

 Score = 138.4 bits 1239,  Expect = 3e-34
 Identities = 217/256 84%, Positives = 228/256 89%, Gaps = 38/256 14%
Query  25   HIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPCSQQQQQPLSQQQQPPFSQ 84
            HIP LE+P QQQPLP QQ L  +QQQQPIQQQPQPF QQ PCSQQQQ PLSQQQQPPFSQ
Sbjct  1    HIPSLEKPLQQQPLPLQQIL-WYQQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQ 59
Query  85   QQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQPVLPQQPSFSQQ 144
            QQPPFSQQQQ         P   QQPPFSQQQQ         F QQQQP+LPQQP     
Sbjct  60   QQPPFSQQQQ---------PILPQQPPFSQQQQQ--------FPQQQQPLLPQQP----- 97
Query  145  QLPPFSQQQSPFSQQQQIVLQQQPPF-LQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHP 203
               PFSQQQ PFSQQQQ     QPPF  QQQQP L QQPPFSQ+QQ  VLPQQQIP V+P
Sbjct  98   ---PFSQQQPPFSQQQQ-----QPPFSQQQQQPILLQQPPFSQHQQP-VLPQQQIPSVQP 148
Query  204  SILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAI 263
            SILQQLNPCKVFLQQQCSPVAMPQSLARSQML QSSCHVMQQQCC+QLPQIP+QSRY+AI
Sbjct  149  SILQQLNPCKVFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCRQLPQIPEQSRYDAI 208
Query  264  RAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLGQ----QPQQ 313
            RAIIYSI+LQEQQ+ QG  Q  QQQPQQ  Q VSQPQQQ Q+QLGQ    QPQQ
Sbjct  209  RAIIYSIVLQEQQHGQGLNQPQQQQPQQSVQGVSQPQQQ-QKQLGQCSFQQPQQ 261

Sequence Alignment: 7. Allergen Name: Tri a glutenin Sequence ID: CAA44473

 Score = 131.0 bits 1166,  Expect = 6e-32
 Identities = 234/273 85%, Positives = 251/273 91%, Gaps = 101/273 36%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFL+FALLA+VATSAIAQM+ S IPGLERP QQQPLPPQQT+            PQ  
Sbjct  1    MKTFLVFALLAVVATSAIAQMDTSCIPGLERPWQQQPLPPQQTF------------PQ-- 46
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
                              QPPFSQ      QQQQQP+ Q  QP FSQQQP +     P  
Sbjct  47   ------------------QPPFSQ------QQQQQPFPQ--QPSFSQQQPIL-----P-- 73
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
              Q PPF QQ QPVLPQQ               SPFSQQQQ++L                
Sbjct  74   --QGPPFPQQTQPVLPQQ---------------SPFSQQQQLIL---------------- 100
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
             PP  QQQQQ  LPQQQI  V+PS+LQQLNPCKVFLQQQCSPVA+PQ LARSQM QQSSC
Sbjct  101  -PP--QQQQQ--LPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAIPQRLARSQMWQQSSC 155
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
            HVMQQQCCQQL QIP+QSRY+AIRAI YSIILQEQQQ  G  Q+ QQQPQQ GQ VSQ Q
Sbjct  156  HVMQQQCCQQLSQIPEQSRYDAIRAITYSIILQEQQQ--G--QSQQQQPQQSGQGVSQSQ 211
Query  301  QQSQQQLGQ------------QPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVN 348
            QQSQQQLGQ            QPQQQQ+ QGTFLQPHQIA+LEVMTSIALRTLPTMC VN
Sbjct  212  QQSQQQLGQCSFQQPQQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVN 271
Query  349  VPLYRTTTSVPFGV 362
            VPLY +TTSVPFGV
Sbjct  272  VPLYSSTTSVPFGV 285

Sequence Alignment: 8. Allergen Name: Tri a gliadin Sequence ID: AAA34285

 Score = 119.3 bits 1050,  Expect = 2e-28
 Identities = 250/289 86%, Positives = 264/289 91%, Gaps = 95/289 32%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFL+FAL+A+VATSAIAQME S I GLERP QQQPLPPQQ++S               
Sbjct  1    MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFS--------------- 45
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
                                    QQPPFSQQQQQPL QQ  P FSQQQPPFSQQQ  P 
Sbjct  46   ------------------------QQPPFSQQQQQPLPQQ--PSFSQQQPPFSQQQ--PI 77
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
              QQPPFSQQQQPVLPQQ               SPFSQQQQ+VL   PP           
Sbjct  78   LSQQPPFSQQQQPVLPQQ---------------SPFSQQQQLVL---PP----------- 108
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
                 QQQQQLV  QQQIP V+PS+LQQLNPCKVFLQQQCSPVAMPQ LARSQM QQSSC
Sbjct  109  ----QQQQQQLV--QQQIPIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSC 162
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
            HVMQQQCCQQL QIP+QSRYEAIRAIIYSIILQEQQ  QG +Q  QQQPQQ GQ VSQ Q
Sbjct  163  HVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQEQQ--QGFVQPQQQQPQQSGQGVSQSQ 220
Query  301  QQSQQQLGQ----QPQQQ-----------QLAQGTFLQPHQIAQLEVMTSIALRTLPTMC 345
            QQSQQQLGQ    QPQQQ           Q+ QGTFLQPHQIA+LE +TSIALRTLPTMC
Sbjct  221  QQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMC 280
Query  346  RVNVPLYRTTTSVPFGVGTGVGSY 369
             VNVPLY  TTSVPFGVGTGVG+Y
Sbjct  281  SVNVPLYSATTSVPFGVGTGVGAY 304

Sequence Alignment: 9. Allergen Name: Tri a glutenin Sequence ID: CAA59338

 Score = 108.9 bits 947,  Expect = 2e-25
 Identities = 190/225 84%, Positives = 201/225 89%, Gaps = 86/225 38%
Query  7    FALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPC 66
            FAL+A+VATS IAQME S IPGLERP QQQPLPPQQTL               F QQQP 
Sbjct  1    FALIAVVATSTIAQMETSCIPGLERPWQQQPLPPQQTL---------------FPQQQPF 45
Query  67   SQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPP 126
                  P   QQQPPFSQQQP FSQ         QQPPFSQQQP +     P     +PP
Sbjct  46   ------P---QQQPPFSQQQPSFSQ---------QQPPFSQQQPIL-----P-----EPP 77
Query  127  FSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQ 186
            FS QQQPVLPQQ               SPFSQQQ ++    PP                Q
Sbjct  78   FSLQQQPVLPQQ---------------SPFSQQQLVL----PP----------------Q 102
Query  187  QQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQ 246
            QQQQ  LPQQQI  V+PS+LQQLNPCKVFLQQQCSPVAMPQ LARSQM QQS CHVMQQQ
Sbjct  103  QQQQ--LPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSRCHVMQQQ 160
Query  247  CCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQ 306
            CCQQL QIP+QSRY+AI AI YSIILQEQQ  QG +Q  QQQPQQ GQ VSQ QQQSQQQ
Sbjct  161  CCQQLSQIPEQSRYDAICAITYSIILQEQQ--QGFVQAQQQQPQQSGQGVSQSQQQSQQQ 218
Query  307  LGQ----QPQQ 313
            LGQ    QPQQ
Sbjct  219  LGQCSFQQPQQ 229

Sequence Alignment: 10. Allergen Name: Tri a glutenin Sequence ID: CAA36063

 Score = 108.8 bits 946,  Expect = 3e-25
 Identities = 238/282 84%, Positives = 256/282 90%, Gaps = 99/282 35%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFL+FALLA+VATS IAQME S IPGLERP Q+QPLPPQ+TL               F
Sbjct  1    MKTFLVFALLAVVATSTIAQMETSCIPGLERPWQEQPLPPQHTL---------------F 45
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
                P    QQQP+ QQQQPPFSQQQP F   QQQP+  Q                    
Sbjct  46   ----P----QQQPFPQQQQPPFSQQQPSF--LQQQPILPQL------------------- 76
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
                 PFSQQQQPVLPQQ               SPFSQQQ ++    PP           
Sbjct  77   -----PFSQQQQPVLPQQ---------------SPFSQQQLVL----PP----------- 101
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
                 QQQ Q VL QQQIP V+PS+LQQLNPCKVFLQQQC+PVAMPQ LARSQMLQQSSC
Sbjct  102  -----QQQYQQVL-QQQIPIVQPSVLQQLNPCKVFLQQQCNPVAMPQRLARSQMLQQSSC 155
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
            HVMQQQCCQQLPQIP+QSRY+ IRAI YSIILQEQQQ  G +Q  QQQPQQLGQ VSQ Q
Sbjct  156  HVMQQQCCQQLPQIPEQSRYDVIRAITYSIILQEQQQ--GFVQAQQQQPQQLGQGVSQSQ 213
Query  301  QQSQQQLGQ------------QPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVN 348
            QQSQQQLGQ            QPQQQQ+ QGTFLQPHQIA+LEVMTSIALRTLPTMC VN
Sbjct  214  QQSQQQLGQCSFQQPQQQLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVN 273
Query  349  VPLYRTTTSVPFGVGTGVGSY 369
            VPLY +TTSVPF VGTGVG+Y
Sbjct  274  VPLYSSTTSVPFSVGTGVGAY 294

Sequence Alignment: 11. Allergen Name: Tri a gliadin Sequence ID: AAA34286

 Score = 106.3 bits 922,  Expect = 2e-24
 Identities = 196/268 73%, Positives = 213/268 79%, Gaps = 28/268 10%
Query  90   SQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQPVLPQQPSFSQQQLPPF 149
            S  +  PL+    P       P +++   P +  Q       +  LP+  +  QQQ PPF
Sbjct  40   SPGHNNPLNNNNSP---NNNSPSNHHNNSPNNNFQYHTHPSNHKNLPHTNNIQQQQ-PPF 95
Query  150  SQQQSP-FSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQ 208
            SQQQ P FSQQQQ VL QQ PF QQQQ  LP Q    QQQQQLV  QQQIP V+PS+LQQ
Sbjct  96   SQQQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQ----QQQQQLV--QQQIPIVQPSVLQQ 149
Query  209  LNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIY 268
            LNPCKVFLQQQCSPVAMPQ LARSQM QQSSCHVMQQQCCQQL QIP+QSRYEAIRAIIY
Sbjct  150  LNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIY 209
Query  269  SIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLGQ----QPQQQ---------- 314
            SIILQEQQ  QG +Q  QQQPQQ GQ VSQ QQQSQQQLGQ    QPQQQ          
Sbjct  210  SIILQEQQ--QGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQ 267
Query  315  -QLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPFGVGTGVGSY 369
             Q+ QGTFLQPHQIA+LE +TSIALRTLPTMC VNVPLY  TTSVPFGVGTGVG+Y
Sbjct  268  QQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGAY 323

Sequence Alignment: 12. Allergen Name: Tri a gliadin Sequence ID: AAA34289

 Score = 89.8 bits 759,  Expect = 2e-19
 Identities = 170/323 52%, Positives = 210/323 65%, Gaps = 46/323 14%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKT+LI+ +LA+  T   A ++    P  +    QQ L PQ  L +   QQP Q  PQP 
Sbjct  1    MKTLLILTILAMAITIGTANIQVD--PSGQVQWLQQQLVPQ--LQQPLSQQPQQTFPQP- 55
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
             Q  P   QQQ P  QQ Q PF Q Q PF QQ QQP+ Q QQP     Q PF QQ Q PF
Sbjct  56   QQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQP-----QQPFPQQPQQPF 110
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP-PFLQQQQPSLP 179
             Q Q P    QQP +PQQP   QQ +P   Q Q PF Q QQ    QQP P  QQQ P  P
Sbjct  111  PQTQQP----QQP-FPQQP---QQPFPQTQQPQQPFPQLQQ---PQQPFPQPQQQLPQ-P 158
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSS 239
            QQP    QQ    +PQQQ PF++PS+ QQLNPCK  L QQ  P ++  SL  S +  QS 
Sbjct  159  QQP----QQS---FPQQQRPFIQPSLQQQLNPCKNILLQQSKPASLVSSLW-SIIWPQSD 210
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQP 299
            C+VM+QQCCQQL QIPQQ +  AI ++++SII+Q+QQ          QQ QQ G  +  P
Sbjct  211  CQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQ----------QQQQQQGIDIFLP 260
Query  300  QQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVP 359
              Q ++Q+GQ    Q   QG  +QP+Q AQLE + S+ L+TLP+MC V VP   +    P
Sbjct  261  LSQ-HEQVGQGSLVQ--GQG-IIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAP 316
Query  360  FG-VGTGVG 367
            F  +  G+G
Sbjct  317  FASIVAGIG 325

Sequence Alignment: 13. Allergen Name: Tri a gliadin Sequence ID: CAA35238

 Score = 84.1 bits 702,  Expect = 9e-18
 Identities = 172/298 57%, Positives = 213/298 71%, Gaps = 74/298 24%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A             R + + P+P      + Q Q P QQQPQ  
Sbjct  1    MKTFLILALLAIVATTA-------------RIAVRVPVP------QLQPQNPSQQQPQ-- 39
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQ----QQPLSQQQQPPFSQQQPPFSQQQ 116
             +Q P  QQQQ P  QQQ  PF  QQP + Q Q    QQP  Q Q  PF Q Q P+ Q Q
Sbjct  40   -EQVPLVQQQQFP-GQQQ--PFPPQQP-YPQPQPFPSQQPYLQLQ--PFPQPQLPYPQPQ 92
Query  117  QPPFSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQP 176
             P + Q Q P+ Q Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ 
Sbjct  93   LP-YPQPQLPYPQPQ-PFRPQQP-YPQSQ-PQYSQPQQPISQQQQ---QQQ----QQQQQ 141
Query  177  SLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQ 236
               QQ    QQQQQ +L  QQI      + QQL PC+  + QQ S +A       SQ+LQ
Sbjct  142  K--QQ----QQQQQQIL--QQI------LQQQLIPCRDVVLQQHS-IAY----GSSQVLQ 182
Query  237  QSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQC- 295
            QS+ +++QQ CCQQL QIP+QSR +AI  ++++IIL++QQQ     Q  QQQ Q L Q  
Sbjct  183  QSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQ-----QQQQQQQQPLSQVS 237
Query  296  VSQPQQQSQQQLGQ-QPQQQQ-LAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYR 353
              QPQQQ     G  QP QQ   AQG+ +QP+Q+ Q+E + ++AL TLP MC V +P Y 
Sbjct  238  FQQPQQQYPSGQGSFQPSQQNPQAQGS-VQPQQLPQFEEIRNLALETLPAMCNVYIPPY- 295
Query  354  TTTSVPFGV-GT 364
              T  P G+ GT
Sbjct  296  -CTIAPVGIFGT 306

Sequence Alignment: 14. Allergen Name: Tri a 20.0101 Sequence ID: BAN29066

 Score = 83.3 bits 695,  Expect = 1e-17
 Identities = 149/272 54%, Positives = 176/272 64%, Gaps = 37/272 13%
Query  62   QQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQ--PPFSQQQPPFSQQQQPP 119
            Q  P S Q Q P    QQ P  Q + PFSQQ QQ + Q QQ  P   QQQ P  QQ Q  
Sbjct  3    QVDP-SSQVQWP----QQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQ 57
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            F Q Q PF QQ Q   PQQP    QQ  PF Q Q P    QQ+  Q Q P   QQQ S P
Sbjct  58   FLQPQQPFPQQPQQPYPQQP----QQ--PFPQTQQP----QQLFPQSQQP---QQQFSQP 104
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSS 239
            QQ     QQ Q  +PQQQ PF++PS+ QQ+NPCK FL QQC PV++  SL  S +  QS 
Sbjct  105  QQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSD 163
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQP 299
            C+VM+QQCCQQL QIPQQ +  AI  II+SII+Q++QQ            QQ G  +  P
Sbjct  164  CQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQ-----------EQQQGMHILLP 212
Query  300  QQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVP 359
              Q QQQ+GQ    Q   QG  +QP+Q AQLE + S+ L+TLPTMC V VP   +    P
Sbjct  213  LYQ-QQQVGQGTLVQ--GQG-IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAP 268
Query  360  FG-VGTGVG 367
            F  V  G+G
Sbjct  269  FSSVVAGIG 277

Sequence Alignment: 15. Allergen Name: Tri a gliadin Sequence ID: AAA34282

 Score = 82.0 bits 682,  Expect = 4e-17
 Identities = 166/292 56%, Positives = 208/292 71%, Gaps = 76/292 26%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+AL AIVAT+A   +             + P+P      + Q Q P QQQPQ  
Sbjct  1    MKTFLILALRAIVATTATIAV-------------RVPVP------QLQPQNPSQQQPQ-- 39
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
             +Q P  QQQQ P  QQQ  PF  QQP     QQQP+  QQ  P+ Q QP F Q Q P +
Sbjct  40   -KQVPLVQQQQFP-GQQQ--PFPPQQP---YPQQQPFPSQQ--PYMQLQP-FPQPQLP-Y 88
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+ Q Q P  PQQ S+ Q Q P +SQ Q P SQQQQ   QQQ    QQQQ     
Sbjct  89   PQPQLPYPQPQ-PFRPQQ-SYPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----- 133
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
                  QQQQ++   QQI      + QQL PC+  + QQ S +A       SQ+LQQS+ 
Sbjct  134  ------QQQQIL---QQI------LQQQLIPCRDVVLQQHS-IAH----GSSQVLQQSTY 173
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQ-CVSQP 299
            +++QQ CCQQL QIP+QSR +AI  ++++IIL++QQQ Q   Q  QQQP  L Q C  Q 
Sbjct  174  QLVQQFCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQQQQP--LSQVCFQQS 231
Query  300  QQQSQQQLGQ-QPQQQQ-LAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
            QQQ     G  QP QQ   AQG+ +QP+Q+ Q+E + ++AL TLP MC V +P Y   T 
Sbjct  232  QQQYPSGQGSFQPSQQNPQAQGS-VQPQQLPQFEEIRNLALETLPAMCNVYIPPY--CTI 288
Query  358  VPFGV-GT 364
             P G+ GT
Sbjct  289  APVGIFGT 296

Sequence Alignment: 16. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 81.5 bits 677,  Expect = 4e-17
 Identities = 143/236 60%, Positives = 166/236 70%, Gaps = 62/236 26%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKT+LI+ +LA+  T   A M+         PS Q   P         QQQP+ Q  QPF
Sbjct  1    MKTLLILTILAMAITIGTANMQVD-------PSSQVQWP---------QQQPVPQPHQPF 44
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQ P   QQ  P  QQ  P   QQQ P   Q QQP   QQQ  F Q Q PF QQ Q P+
Sbjct  45   SQQ-P---QQTFPQPQQTFPHQPQQQFP---QPQQP---QQQ--FLQPQQPFPQQPQQPY 92
Query  121  SQQ-QPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
             QQ Q PF Q QQP          QQL P SQQ  P   QQQ     QP   QQQ P  P
Sbjct  93   PQQPQQPFPQTQQP----------QQLFPQSQQ--P---QQQF---SQP---QQQFPQ-P 130
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSS 239
            QQP   QQ     +PQQQ PF++PS+ QQ+NPCK FL QQC PV++  SL  S +  QS 
Sbjct  131  QQP---QQS----FPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSD 182
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGS---IQTPQQQPQQLGQ 294
            C+VM+QQCCQQL QIPQQ +  AI  II+SII+Q++QQ Q     I  P  Q QQ+GQ
Sbjct  183  CQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQ 240

Sequence Alignment: 17. Allergen Name: Tri a gliadin Sequence ID: BAA11251

 Score = 81.5 bits 677,  Expect = 5e-17
 Identities = 148/271 54%, Positives = 180/271 66%, Gaps = 39/271 14%
Query  62   QQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPP-- 119
            Q  P S Q Q P    QQ PF Q + PFSQQ QQ + Q QQ    Q Q  FSQ QQP   
Sbjct  3    QVDP-SGQVQWP----QQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQ 57
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP-PFLQQQQPSL 178
            F Q Q PF QQ Q   PQ+P   QQ +P   Q Q PF Q QQ    QQP P  QQQ P  
Sbjct  58   FIQPQQPFPQQPQQTYPQRP---QQPFPQTQQPQQPFPQSQQ---PQQPFPQPQQQFPQ- 110
Query  179  PQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQS 238
            PQQP    QQ    +PQQQ  +++ S+ QQLNPCK FL QQC PV++  SL  S +L +S
Sbjct  111  PQQP----QQS---FPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLW-SMILPRS 162
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQ 298
             C+VM+QQCCQQL QIPQQ +  AI +I++SII+Q++QQ            Q+ G  +  
Sbjct  163  DCQVMRQQCCQQLAQIPQQLQCAAIHSIVHSIIMQQEQQ-----------EQRQGVQILV 211
Query  299  PQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSV 358
            P  Q QQQ+GQ    Q   QG  +QP+Q AQLEV+ S  L+TL TMC V VP Y +T   
Sbjct  212  PLSQ-QQQVGQGTLVQ--GQG-IIQPQQPAQLEVIRSSVLQTLATMCNVYVPPYCSTIRA 267
Query  359  PFG-VGTGVG 367
            PF  +  G+G
Sbjct  268  PFASIVAGIG 277

Sequence Alignment: 18. Allergen Name: Tri a gliadin Sequence ID: AAA34272

 Score = 79.6 bits 658,  Expect = 2e-16
 Identities = 160/298 53%, Positives = 202/298 67%, Gaps = 71/298 23%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKT+LI+ +LA+  T A A M+      ++ P QQQP+P        Q QQP  QQPQ  
Sbjct  1    MKTLLILTILAMATTIATANMQVDPSGQVQWP-QQQPFP--------QPQQPFCQQPQR- 50
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            +  QP    ++QP   QQ  P  QQ  P   QQQ P +QQ Q PF Q Q  F QQ Q PF
Sbjct  51   TIPQPHQTFHHQP---QQTFPQPQQTYPHQPQQQFPQTQQPQQPFPQPQQTFPQQPQLPF 107
Query  121  SQQ-QPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
             QQ Q PF Q QQP   QQP F Q Q P     Q PF Q         P   QQQ P  P
Sbjct  108  PQQPQQPFPQPQQP---QQP-FPQSQQP-----QQPFPQ---------P---QQQFPQ-P 145
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSS 239
            QQP    QQ    +PQQQ P ++  + QQ+NPCK FL QQC+ V++  SL  S +L +S 
Sbjct  146  QQP----QQS---FPQQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLV-SIILPRSD 197
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQP 299
            C+VMQQQCCQQL QIPQQ +  AI ++ +SII+Q++QQ QG    P          + +P
Sbjct  198  CQVMQQQCCQQLAQIPQQLQCAAIHSVAHSIIMQQEQQ-QG---VP----------ILRP 243
Query  300  QQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVP 359
              Q  Q LG             +QP+Q AQLE + S+ L+TLPTMC V VP   +T +VP
Sbjct  244  LFQLAQGLG------------IIQPQQPAQLEGIRSLVLKTLPTMCNVYVPPDCSTINVP 291
Query  360  FG-VGTGVG 367
            +  +  G+G
Sbjct  292  YANIDAGIG 300

Sequence Alignment: 19. Allergen Name: Tri a gliadin Sequence ID: AAA34276

 Score = 79.3 bits 655,  Expect = 2e-16
 Identities = 161/285 56%, Positives = 205/285 71%, Gaps = 84/285 29%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTF I+ALLAIVAT+A   +             + P+P      + Q Q P QQQPQ  
Sbjct  1    MKTFPILALLAIVATTATTAV-------------RVPVP------QLQLQNPSQQQPQ-- 39
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
                     +Q PL Q+QQ  F  QQ PF  QQ  P    Q  PF  QQP + Q Q  PF
Sbjct  40   ---------EQVPLVQEQQ--FQGQQQPFPPQQPYP----QPQPFPSQQP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+ Q Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ     
Sbjct  82   PQPQLPYPQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----- 126
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQSS 239
                  QQQQ++   QQI      + QQL PC+ V LQQ+   +A       SQ+LQ+S+
Sbjct  127  ------QQQQIL---QQI------LQQQLIPCRDVVLQQH--NIAH----GSSQVLQEST 165
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQC-VSQ 298
             +++QQ CCQQL QIP+QSR +AI  ++++IIL+ QQ+ +   Q  QQQ Q L Q    Q
Sbjct  166  YQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILH-QQHHHHQQQQQQQQQQPLSQVSFQQ 224
Query  299  PQQQ--SQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTT 356
            PQQQ  S Q + Q  QQ   AQG+F QP+Q+ Q+E + ++AL+TLP MC V +P Y   T
Sbjct  225  PQQQYPSGQGFFQPSQQNPQAQGSF-QPQQLPQFEEIRNLALQTLPAMCNVYIPPY--CT 281
Query  357  SVPFGV-GT 364
              PFG+ GT
Sbjct  282  IAPFGIFGT 290

Sequence Alignment: 20. Allergen Name: Tri a gliadin Sequence ID: AAA34290

 Score = 79.2 bits 654,  Expect = 3e-16
 Identities = 169/291 58%, Positives = 209/291 71%, Gaps = 77/291 26%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P           QP   QPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP-----------QP---QPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQ-PPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPP 119
            SQ QP   Q+Q PL QQQQ P  QQQ PP     QQP  Q Q  PF  QQP + Q Q  P
Sbjct  34   SQPQP---QRQVPLVQQQQFPGQQQQFPP-----QQPYPQPQ--PFPSQQP-YLQLQ--P 80
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            F Q QP F  Q  P  PQ P FS QQ  P+ Q Q  + Q QQ + QQQ    QQQQ    
Sbjct  81   FPQPQP-FPPQL-PY-PQPPPFSPQQ--PYPQPQPQYPQPQQPISQQQA---QQQQQQQQ 132
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQS 238
            QQ    QQQQQ +LPQ         + QQL PC+ V LQQ+   +A     ARSQ+LQQS
Sbjct  133  QQQ--QQQQQQQILPQI--------LQQQLIPCRDVVLQQHN--IAH----ARSQVLQQS 176
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL-QEQQQVQGSIQTPQQQPQQLGQCVS 297
            + + +QQ CCQQL QIP+QSR +AI  ++++IIL Q+QQQ Q S Q   QQPQQ      
Sbjct  177  TYQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQPSSQVSLQQPQQ------ 230
Query  298  QPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
              Q  S Q + Q  QQ   AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y +TT+
Sbjct  231  --QYPSGQGFFQPSQQNPQAQGS-VQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTT 287
Query  358  VPFGV-GT 364
             PFG+ GT
Sbjct  288  APFGIFGT 295

Sequence Alignment: 21. Allergen Name: Tri a gliadin Sequence ID: AAA34274

 Score = 78.7 bits 649,  Expect = 4e-16
 Identities = 140/261 53%, Positives = 175/261 67%, Gaps = 35/261 13%
Query  67   SQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPP 126
            +  Q  P  Q Q P    QQ PF  Q +QP+SQQ Q  F Q Q  F +Q Q  F Q Q P
Sbjct  19   ANMQADPSGQVQWP----QQQPF-LQPHQPFSQQPQQIFPQPQQTFPHQPQQQFPQPQQP 73
Query  127  FSQQQQPVLPQQPSFSQQQLPPFSQQ-QSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFS 185
               QQQ + P+QP F QQ   P+ QQ Q PF Q QQ     Q PF Q +QP    Q PF 
Sbjct  74   ---QQQFLQPRQP-FPQQPQQPYPQQPQQPFPQTQQ----PQQPFPQSKQP----QQPFP 121
Query  186  QQQQ-QLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQ 244
            Q QQ Q  +PQQQ  +++ S+ QQLNPCK FL QQC PV++  SL  S +L  S C+VM+
Sbjct  122  QPQQPQQSFPQQQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLW-SIILPPSDCQVMR 180
Query  245  QQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQ 304
            QQCCQQL QIPQQ +  AI ++++SII+Q++QQ Q  +Q  Q         +  P  Q Q
Sbjct  181  QQCCQQLAQIPQQLQCAAIHSVVHSIIMQQEQQEQ--LQGVQ---------ILVPLSQ-Q 228
Query  305  QQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPF 360
            QQ+GQ    Q   QG  +QP+Q AQLEV+ S+ L+TLPTMC V VP Y +T   PF
Sbjct  229  QQVGQGILVQ--GQG-IIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPF 281

Sequence Alignment: 22. Allergen Name: Tri a gliadin Sequence ID: CAA26383

 Score = 78.2 bits 644,  Expect = 5e-16
 Identities = 169/291 58%, Positives = 208/291 71%, Gaps = 77/291 26%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P           QP   QPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP-----------QP---QPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQ-PPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPP 119
            SQ QP   Q Q PL QQQQ P  QQQ PP     QQP  Q Q  PF  QQP + Q Q  P
Sbjct  34   SQPQP---QGQVPLVQQQQFPGQQQQFPP-----QQPYPQPQ--PFPSQQP-YLQLQ--P 80
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            F Q QP F  Q  P  PQ P FS QQ  P+ Q Q  + Q QQ + QQQ    QQQQ    
Sbjct  81   FPQPQP-FPPQL-PY-PQPPPFSPQQ--PYPQPQPQYPQPQQPISQQQA---QQQQQQQQ 132
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQS 238
            QQ    QQQQQ +L  QQI      + QQL PC+ V LQQ+   +A     ARSQ+LQQS
Sbjct  133  QQQ--QQQQQQQIL--QQI------LQQQLIPCRDVVLQQHN--IAH----ARSQVLQQS 176
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQ-QVQGSIQTPQQQPQQLGQCVS 297
            + + +QQ CCQQL QIP+QSR +AI  ++++IIL++QQ Q Q S Q   QQPQQ      
Sbjct  177  TYQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQRQQQPSSQVSLQQPQQ------ 230
Query  298  QPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
              Q  S Q + Q  QQ   AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y +TT 
Sbjct  231  --QYPSGQGFFQPSQQNPQAQGS-VQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTI 287
Query  358  VPFGV-GT 364
             PFG+ GT
Sbjct  288  APFGIFGT 295

Sequence Alignment: 23. Allergen Name: Tri a gliadin Sequence ID: AAA34283

 Score = 76.5 bits 627,  Expect = 2e-15
 Identities = 158/277 57%, Positives = 198/277 71%, Gaps = 91/277 32%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A + +             + P+P              Q QPQ  
Sbjct  1    MKTFLILALLAIVATTATSAV-------------RVPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ  F  QQ  P    +Q PF  QQP + Q Q  PF
Sbjct  34   SQQQP---QEQVPLMQQQQQ-FPGQQEQFPPQQPYP----HQQPFPSQQP-YPQPQ--PF 82
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
              Q P    Q QP  PQQP + Q Q P + Q Q P SQQQ           QQQQ     
Sbjct  83   PPQLP--YPQTQPFPPQQP-YPQPQ-PQYPQPQQPISQQQA----------QQQQ----- 123
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQSS 239
                 QQQQ L    QQI      + QQL PC+ V LQQ+   +A     A SQ+LQQSS
Sbjct  124  -----QQQQTL----QQI------LQQQLIPCRDVVLQQH--NIAH----ASSQVLQQSS 162
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQ--EQQQVQGSIQTPQQQPQQLGQCVS 297
             + +QQ CCQQL QIP+QSR +AI  ++++IIL+  +QQQ Q S Q   QQPQ+      
Sbjct  163  YQQLQQLCCQQLFQIPEQSRCQAIHNVVHAIILHHHQQQQQQPSSQVSYQQPQE------ 216
Query  298  QPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
              Q  S Q   Q  QQ   AQG+ +QP+Q+ Q++ + ++AL+TLP MC V +P Y +TT 
Sbjct  217  --QYPSGQVSFQSSQQNPQAQGS-VQPQQLPQFQEIRNLALQTLPAMCNVYIPPYCSTTI 273
Query  358  VPFGV-GT 364
             PFG+ GT
Sbjct  274  APFGIFGT 281

Sequence Alignment: 24. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 74.8 bits 611,  Expect = 6e-15
 Identities = 160/296 54%, Positives = 207/296 69%, Gaps = 84/296 28%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+AL+A  AT+A+                + P+P              Q QP+  
Sbjct  1    MKTFLILALVATTATTAV----------------RVPVP--------------QLQPKNP 30
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQ-PPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPP 119
            SQQQP   Q+Q PL QQQQ P  QQQ PP     QQP  Q Q  PF  QQP + Q Q  P
Sbjct  31   SQQQP---QEQVPLVQQQQFPGQQQQFPP-----QQPYPQPQ--PFPSQQP-YLQLQ--P 77
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            F Q  P      QP LPQ P    Q +PP  QQ  P         QQ+P +LQ QQP   
Sbjct  78   FPQ--P------QPFLPQLPYPQPQSFPP--QQPYP---------QQRPKYLQPQQPISQ 118
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQS 238
            QQ    QQQQQ    QQQ   ++  + QQL PC+ V LQQ+   +A     A SQ+LQQS
Sbjct  119  QQAQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHN--IAH----ASSQVLQQS 172
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQ 298
            + +++QQ CCQQL QIP+QSR +AI  ++++II+++Q+Q Q   Q  QQQ QQ  Q   Q
Sbjct  173  TYQLLQQLCCQQLLQIPEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQ 232
Query  299  PQQQSQQQLGQQPQQQQ-LAQGTF------------LQPHQIAQLEVMTSIALRTLPTMC 345
             QQ S Q   QQPQQQ   +QG+F            +QP+Q+ Q+  + ++AL+TLP MC
Sbjct  233  QQQPSSQVSFQQPQQQYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMC 292
Query  346  RVNVPLYRTTTSVPFGV-GT 364
             V +P + +TT  PFG+ GT
Sbjct  293  NVYIPPHCSTTIAPFGIFGT 312

Sequence Alignment: 25. Allergen Name: Tri a gliadin Sequence ID: CAA26385

 Score = 74.6 bits 609,  Expect = 6e-15
 Identities = 160/296 54%, Positives = 208/296 70%, Gaps = 84/296 28%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+AL+A  AT+A+                + P+P              Q QP+  
Sbjct  1    MKTFLILALVATTATTAV----------------RVPVP--------------QLQPKNP 30
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQ-PPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPP 119
            SQQQP   Q+Q PL QQQQ P  QQQ PP     QQP  Q Q  PF  QQP + Q Q  P
Sbjct  31   SQQQP---QEQVPLVQQQQFPGQQQQFPP-----QQPYPQPQ--PFPSQQP-YLQLQ--P 77
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            F    P    Q QP LPQ P    Q +PP    Q P+ QQ+ + LQ Q P  QQQ     
Sbjct  78   F----P----QPQPFLPQLPYPQPQSFPP----QQPYPQQRPMYLQPQQPISQQQAQQQQ 125
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQS 238
            QQ    QQQQQ    QQQ   ++  + QQL PC+ V LQQ+   +A     A SQ+LQQS
Sbjct  126  QQ---QQQQQQ----QQQQQILQQILQQQLIPCRDVVLQQH--NIAH----ASSQVLQQS 172
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQ 298
            + +++QQ CCQQL QIP+QSR +AI  ++++II+++Q+Q Q   Q  QQQ QQ  Q   Q
Sbjct  173  TYQLLQQLCCQQLLQIPEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQ 232
Query  299  PQQQSQQQLGQQPQQQQ-LAQGTF------------LQPHQIAQLEVMTSIALRTLPTMC 345
             QQ S Q   QQPQQQ   +QG+F            +QP+Q+ Q+  + ++AL+TLP MC
Sbjct  233  QQQPSSQVSFQQPQQQYPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMC 292
Query  346  RVNVPLYRTTTSVPFGV-GT 364
             V +P + +TT  PFG+ GT
Sbjct  293  NVYIPPHCSTTIAPFGIFGT 312

Sequence Alignment: 26. Allergen Name: Tri a gliadin Sequence ID: CAA26384

 Score = 74.3 bits 606,  Expect = 7e-15
 Identities = 164/278 58%, Positives = 208/278 74%, Gaps = 93/278 33%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ LLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILVLLAIVATTATTAV-------------RFPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  Q P + Q Q  PF
Sbjct  34   SQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQLP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ QQ   PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   PQPQLPYSQPQQ-FRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPC-KVFLQQQCSPVAMPQSLARSQMLQQSS 239
            Q    QQQQQ++   QQI      + QQL PC  V LQQ+   +A      RSQ+LQQS+
Sbjct  128  Q----QQQQQIL---QQI------LQQQLIPCMDVVLQQH--NIAH----GRSQVLQQST 168
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQ 294
             +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ
Sbjct  169  YQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQ 228
Query  295  CVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRT 354
               +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y  
Sbjct  229  GSFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY-- 274
Query  355  TTSVPFGV-GT 364
             T  PFG+ GT
Sbjct  275  CTIAPFGIFGT 285

Sequence Alignment: 27. Allergen Name: Tri a gliadin Sequence ID: AAA17741

 Score = 74.1 bits 604,  Expect = 8e-15
 Identities = 163/280 58%, Positives = 208/280 74%, Gaps = 90/280 32%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  QQP + Q Q  PF
Sbjct  34   SQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQQP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   LQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
            Q    QQQQQ++   QQI      + QQL PC   + QQ + V       +SQ+LQQS+ 
Sbjct  128  Q---QQQQQQII---QQI------LQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTY 170
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQC 295
            +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ 
Sbjct  171  QLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQG 230
Query  296  VSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTT 355
              +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y   
Sbjct  231  SFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY--C 276
Query  356  TSVPFGV-GT 364
            T  PFG+ GT
Sbjct  277  TIAPFGIFGT 286

Sequence Alignment: 28. Allergen Name: Tri a gliadin Sequence ID: AAA34275

 Score = 73.9 bits 602,  Expect = 1e-14
 Identities = 172/295 58%, Positives = 218/295 73%, Gaps = 91/295 30%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P      + Q Q P QQQPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP------QLQPQNPSQQQPQ-- 39
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQ-PP 119
             +Q P  QQQQ P  QQQ PP   QQP     Q QP+  QQ  P+ Q QP F Q Q  PP
Sbjct  40   -EQVPLVQQQQFPGQQQQFPP---QQP---YPQPQPFPSQQ--PYLQLQP-FPQPQPFPP 89
Query  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
            +   QP    Q  P  PQQP + QQQ P + Q Q P SQQQ    QQQ    QQQQ    
Sbjct  90   LPYPQP----QSFP--PQQP-YPQQQ-PQYLQPQQPISQQQA---QQQ----QQQQ---- 130
Query  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQS 238
            QQ    QQQQQ +L  QQI      + QQL PC+ V LQQ+   +A     A SQ+LQQS
Sbjct  131  QQ----QQQQQQIL--QQI------LQQQLIPCRDVVLQQH--NIAH----ASSQVLQQS 172
Query  239  SCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQG----SIQTPQQQPQQLGQ 294
            + +++QQ CCQQL QIP+QS+ +AI  + ++II+++QQQ Q      +Q  QQQ QQL Q
Sbjct  173  TYQLLQQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQ 232
Query  295  CVSQPQQQSQQQLG-QQPQQQ-----------QL---AQGTFLQPHQIAQLEVMTSIALR 339
               Q QQQ   Q+  QQPQQQ           QL   AQG+ +QP+Q+ Q+  + ++AL+
Sbjct  233  QQQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGS-VQPQQLPQFAEIRNLALQ 291
Query  340  TLPTMCRVNVPLYRTTTSVPFGV-GT 364
            TLP MC V +P + +TT  PFG+ GT
Sbjct  292  TLPAMCNVYIPPHCSTTIAPFGISGT 317

Sequence Alignment: 29. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 73.8 bits 601,  Expect = 1e-14
 Identities = 172/297 57%, Positives = 217/297 73%, Gaps = 88/297 29%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P      + Q Q P QQQPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP------QLQPQNPSQQQPQ-- 39
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
             +Q P  QQQQ P  QQQ PP   QQP     Q QP+  QQ  P+ Q QP F Q Q  PF
Sbjct  40   -EQVPLVQQQQFPGQQQQFPP---QQP---YPQPQPFPSQQ--PYLQLQP-FPQPQ--PF 87
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
              Q P    Q  P  PQQP + QQQ P + Q Q P SQQQ    QQQ    QQQQ    Q
Sbjct  88   PPQLPYPQPQSFP--PQQP-YPQQQ-PQYLQPQQPISQQQA---QQQ----QQQQ----Q 132
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQSS 239
            Q    QQQQQ +L  QQI      + QQL PC+ V LQQ+   +A     A SQ+LQQS+
Sbjct  133  Q----QQQQQQIL--QQI------LQQQLIPCRDVVLQQH--NIAH----ASSQVLQQST 174
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQG----SIQTPQQQPQQLGQC 295
             +++QQ CCQQL QIP+QS+ +AI  + ++II+++QQQ Q      +Q  QQQ QQL Q 
Sbjct  175  YQLLQQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQ 234
Query  296  VSQPQQQSQQQLG-QQPQQQ-----------QL---AQGTFLQPHQIAQLEVMTSIALRT 340
              Q QQQ   Q+  QQPQQQ           QL   AQG+ +QP+Q+ Q+  + ++AL+T
Sbjct  235  QQQQQQQPSSQVSFQQPQQQYPSSQVSFQPSQLNPQAQGS-VQPQQLPQFAEIRNLALQT 293
Query  341  LPTMCRVNVPLYRTTTSVPFGV-GT 364
            LP MC V +P + +TT  PFG+ GT
Sbjct  294  LPAMCNVYIPPHCSTTIAPFGISGT 318

Sequence Alignment: 30. Allergen Name: Tri a gliadin Sequence ID: AAA34280

 Score = 73.5 bits 598,  Expect = 1e-14
 Identities = 164/278 58%, Positives = 208/278 74%, Gaps = 93/278 33%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ LLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILVLLAIVATTATTAV-------------RFPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  Q P + Q Q  PF
Sbjct  34   SQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQLP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   PQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPC-KVFLQQQCSPVAMPQSLARSQMLQQSS 239
            Q    QQQQQ++   QQI      + QQL PC  V LQQ+   +A      RSQ+LQQS+
Sbjct  128  Q----QQQQQIL---QQI------LQQQLIPCMDVVLQQH--NIAH----GRSQVLQQST 168
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQ 294
             +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ
Sbjct  169  YQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQ 228
Query  295  CVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRT 354
               +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y  
Sbjct  229  GSFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY-- 274
Query  355  TTSVPFGV-GT 364
             T  PFG+ GT
Sbjct  275  CTIAPFGIFGT 285

Sequence Alignment: 31. Allergen Name: Tri a gliadin Sequence ID: CAA25593

 Score = 73.2 bits 595,  Expect = 2e-14
 Identities = 164/278 58%, Positives = 208/278 74%, Gaps = 93/278 33%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ LLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILVLLAIVATTATTAV-------------RFPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  Q P + Q Q  PF
Sbjct  34   SQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQLP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   PQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPC-KVFLQQQCSPVAMPQSLARSQMLQQSS 239
            Q    QQQQQ++   QQI      + QQL PC  V LQQ+   +A      RSQ+LQQS+
Sbjct  128  Q----QQQQQIL---QQI------LQQQLIPCMDVVLQQH--NIAH----GRSQVLQQST 168
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQ 294
             +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ
Sbjct  169  YQLLQELCCQHLWQIPEQSQCQAILKVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQ 228
Query  295  CVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRT 354
               +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y  
Sbjct  229  GSFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY-- 274
Query  355  TTSVPFGV-GT 364
             T  PFG+ GT
Sbjct  275  CTIAPFGIFGT 285

Sequence Alignment: 32. Allergen Name: Tri a gliadin Sequence ID: CAA25261

 Score = 73.2 bits 595,  Expect = 2e-14
 Identities = 163/278 58%, Positives = 207/278 74%, Gaps = 93/278 33%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ LLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILVLLAIVATTATTAV-------------RFPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQ P   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  Q P + Q Q  PF
Sbjct  34   SQQLP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQLP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   PQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPC-KVFLQQQCSPVAMPQSLARSQMLQQSS 239
            Q    QQQQQ++   QQI      + QQL PC  V LQQ+   +A      RSQ+LQQS+
Sbjct  128  Q----QQQQQIL---QQI------LQQQLIPCMDVVLQQH--NIAH----GRSQVLQQST 168
Query  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQ 294
             +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ
Sbjct  169  YQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQ 228
Query  295  CVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRT 354
               +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++AL+TLP MC V +P Y  
Sbjct  229  GSFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLALQTLPAMCNVYIPPY-- 274
Query  355  TTSVPFGV-GT 364
             T  PFG+ GT
Sbjct  275  CTIAPFGIFGT 285

Sequence Alignment: 33. Allergen Name: Hor v 20.0101 Sequence ID: P80198

 Score = 69.7 bits 560,  Expect = 2e-13
 Identities = 145/271 53%, Positives = 189/271 69%, Gaps = 55/271 20%
Query  53   IQQQPQPFSQQQPCSQQ---QQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQ 109
            +Q  P  +  ++P  QQ   Q QPL Q  QPPF QQ+P     QQQPL QQQ  PF QQ 
Sbjct  6    MQFNPSGLELERP--QQLFPQWQPLPQ--QPPFLQQEPEQPYPQQQPLPQQQ--PFPQQ- 58
Query  110  PPFSQQQQPPFSQQQPPFSQQQQPV-LPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP 168
            P + +Q+Q  F QQ P   QQQ P  +P QP   QQQ+P    QQ P+  QQQ  + QQ 
Sbjct  59   PQLPHQHQ--FPQQLP---QQQFPQQMPLQP---QQQFP----QQMPLQPQQQPQFPQQK 106
Query  169  PFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCS---PVAM 225
            PF Q QQP L QQP + QQQ    L QQQ P +     +QLN CK FL QQC+    V +
Sbjct  107  PFGQYQQP-LTQQP-YPQQQP---LAQQQ-PSIEEQ--HQLNLCKEFLLQQCTLDEKVPL 158
Query  226  PQSLA---RSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSI 282
             QS+    R ++ QQ+SC++ +QQCCQQL  I +QSR  AI+ I+++I++Q+Q Q Q   
Sbjct  159  LQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGH 218
Query  283  QTPQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLP 342
               Q Q QQLGQ    P Q     L QQP Q       F+ P+Q AQ++V+ S+ ++TLP
Sbjct  219  GFVQSQLQQLGQ--GMPIQ-----LQQQPGQ------AFVLPQQQAQFKVVGSLVIQTLP 265
Query  343  TMCRVNVPLYRTTTSVPFG-VGTGVG 367
             +C V+VP Y +    PFG + TG G
Sbjct  266  MLCNVHVPPYCS----PFGSMATGSG 287

Sequence Alignment: 34. Allergen Name: Hor v 21 Sequence ID: P80198

 Score = 69.7 bits 560,  Expect = 2e-13
 Identities = 145/271 53%, Positives = 189/271 69%, Gaps = 55/271 20%
Query  53   IQQQPQPFSQQQPCSQQ---QQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQ 109
            +Q  P  +  ++P  QQ   Q QPL Q  QPPF QQ+P     QQQPL QQQ  PF QQ 
Sbjct  6    MQFNPSGLELERP--QQLFPQWQPLPQ--QPPFLQQEPEQPYPQQQPLPQQQ--PFPQQ- 58
Query  110  PPFSQQQQPPFSQQQPPFSQQQQPV-LPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP 168
            P + +Q+Q  F QQ P   QQQ P  +P QP   QQQ+P    QQ P+  QQQ  + QQ 
Sbjct  59   PQLPHQHQ--FPQQLP---QQQFPQQMPLQP---QQQFP----QQMPLQPQQQPQFPQQK 106
Query  169  PFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCS---PVAM 225
            PF Q QQP L QQP + QQQ    L QQQ P +     +QLN CK FL QQC+    V +
Sbjct  107  PFGQYQQP-LTQQP-YPQQQP---LAQQQ-PSIEEQ--HQLNLCKEFLLQQCTLDEKVPL 158
Query  226  PQSLA---RSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSI 282
             QS+    R ++ QQ+SC++ +QQCCQQL  I +QSR  AI+ I+++I++Q+Q Q Q   
Sbjct  159  LQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGH 218
Query  283  QTPQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLP 342
               Q Q QQLGQ    P Q     L QQP Q       F+ P+Q AQ++V+ S+ ++TLP
Sbjct  219  GFVQSQLQQLGQ--GMPIQ-----LQQQPGQ------AFVLPQQQAQFKVVGSLVIQTLP 265
Query  343  TMCRVNVPLYRTTTSVPFG-VGTGVG 367
             +C V+VP Y +    PFG + TG G
Sbjct  266  MLCNVHVPPYCS----PFGSMATGSG 287

Sequence Alignment: 35. Allergen Name: Tri a gliadin Sequence ID: AAA34281

 Score = 67.3 bits 537,  Expect = 8e-13
 Identities = 148/255 58%, Positives = 190/255 74%, Gaps = 87/255 34%
Query  1    MKTFLIFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPF 60
            MKTFLI+ALLAIVAT+A   +             + P+P              Q QPQ  
Sbjct  1    MKTFLILALLAIVATTATTAV-------------RVPVP--------------QLQPQNP 33
Query  61   SQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPF 120
            SQQQP   Q+Q PL QQQQ  F  QQ PF  QQ  P    Q  PF  QQP + Q Q  PF
Sbjct  34   SQQQP---QEQVPLVQQQQ--FLGQQQPFPPQQPYP----QPQPFPSQQP-YLQLQ--PF 81
Query  121  SQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQ 180
             Q Q P+SQ Q P  PQQP + Q Q P +SQ Q P SQQQQ   QQQ    QQQQ    Q
Sbjct  82   LQPQLPYSQPQ-PFRPQQP-YPQPQ-PQYSQPQQPISQQQQ---QQQ----QQQQ----Q 127
Query  181  QPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSC 240
            Q    QQQQQ++   QQI      + QQL PC   + QQ + V       +SQ+LQQS+ 
Sbjct  128  Q---QQQQQQII---QQI------LQQQLIPCMDVVLQQHNIVH-----GKSQVLQQSTY 170
Query  241  HVMQQQCCQQLPQIPQQSRYEAIRAIIYSIIL--QEQQQVQGSIQTPQQQPQQ---LGQC 295
            +++Q+ CCQ+L QIP+QS+ +AI  ++++IIL  Q++QQ Q S Q   QQP Q   LGQ 
Sbjct  171  QLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQG 230
Query  296  VSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIA 337
              +P QQ+       PQ    AQG+ +QP+Q+ Q+E + ++A
Sbjct  231  SFRPSQQN-------PQ----AQGS-VQPQQLPQFEEIRNLA 260

Sequence Alignment: 36. Allergen Name: Tri a glutenin Sequence ID: CAA26847

 Score = 58.8 bits 452,  Expect = 8e-10
 Identities = 121/303 39%, Positives = 142/303 46%, Gaps = 25/303 8%
Query  20   QMENSHIPGLER----PSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPCSQQQQQPLS 75
            Q E  + PG  +    P+  Q L   Q   + QQ    QQ   P S QQP   QQ + L+
Sbjct  235  QPEQGQQPGQWQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGHYPTSLQQPGQGQQGHYLA 294
Query  76   QQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQ-PV 134
             QQQP   QQ    + QQQ    QQ + P SQQQP   QQ + P SQQ+P   QQ Q P 
Sbjct  295  SQQQPAQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQGQQGQIPA 354
Query  135  LPQQPSFSQQQLPPFSQQQS------PFSQQQQIVLQQ--QPPFLQQQQPSLPQQPPFSQ 186
              QQP   QQ   P S QQ       P S QQ    QQ  QP   Q+QQP   QQ    Q
Sbjct  355  SQQQPGQGQQGHYPASLQQPGQQGHYPTSLQQLGQGQQIGQPG--QKQQPGQGQQTGQGQ 412
Query  187  QQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQ 246
            Q +Q   P Q     +P+ LQQ  P +   Q Q      P SL +    QQ       QQ
Sbjct  413  QPEQEQQPGQGQQGYYPTSLQQ--PGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPASLQQ 470
Query  247  CCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQ----Q 302
              Q   Q P Q R +  +        Q  Q  QG   T  QQP Q GQ + Q QQ     
Sbjct  471  PGQGQGQ-PGQ-RQQPGQGQHPEQGQQPGQGQQGYYPTSPQQPGQ-GQQLGQGQQGYYPT 527
Query  303  SQQQLGQQPQQQQLAQGTF-LQPHQIAQ 329
            S QQ GQ  Q  Q  QG   + P+Q  Q
Sbjct  528  SPQQPGQGQQPGQGQQGHCPMSPQQTGQ 555

Sequence Alignment: 37. Allergen Name: Tri a gliadin Sequence ID: AAA34284

 Score = 56.4 bits 429,  Expect = 1e-09
 Identities = 100/178 56%, Positives = 134/178 75%, Gaps = 49/178 27%
Query  144  QQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLVLPQQQIPFVHP 203
            Q  P +SQ Q P SQQQQ   QQQ    QQQQ          QQQ+Q +L  QQI     
Sbjct  2    QPQPQYSQPQQPISQQQQ---QQQ----QQQQ---------QQQQEQQIL--QQI----- 38
Query  204  SILQQLNPC-KVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEA 262
             + QQL PC  V LQQ+   +A      RSQ+LQQS+ +++Q+ CCQ+L QIP+QS+ +A
Sbjct  39   -LQQQLIPCMDVVLQQH--NIAH----GRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQA 91
Query  263  IRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLGQ---QPQQQQ-LAQ 318
            I  ++++IIL++QQQ Q      QQQP        QP QQ    LGQ   +P QQ   AQ
Sbjct  92   IHNVVHAIILHQQQQKQ------QQQPSSQFS-FQQPLQQ--YPLGQGSFRPSQQNPQAQ 142
Query  319  GTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVPFGV-GT 364
            G+ +QP+Q+ Q+E+  ++AL+TLP MC V +P Y   T  PFG+ GT
Sbjct  143  GS-VQPQQLPQFEI-RNLALQTLPAMCNVYIPPY--CTIAPFGIFGT 185

Sequence Alignment: 38. Allergen Name: Tri a gliadin Sequence ID: CAA28208

 Score = 55.4 bits 419,  Expect = 2e-09
 Identities = 85/115 73%, Positives = 95/115 82%, Gaps = 20/115 17%
Query  245  QQCCQQLPQIPQQSRYEAIRAIIYSIILQ-EQQQVQGSIQTPQQQ-----PQQLG-QCVS 297
            QQ C   P  PQQ      R ++ S  +Q +QQQV    Q  QQQ     P Q+    VS
Sbjct  29   QQTC---PLPPQQ------RGVLLSCAFQNQQQQVVFFEQITQQQISTFQPLQIFILSVS 79
Query  298  QPQQQ-SQQQLGQQPQQQQ-LAQ-GTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRT 354
            QPQQQ SQQQLGQQPQQQQ LAQ GTFLQP+Q+AQLE+MTSIALRTLP+MCRVNVPL RT
Sbjct  80   QPQQQQSQQQLGQQPQQQQQLAQQGTFLQPQQVAQLELMTSIALRTLPSMCRVNVPLSRT 139
Query  355  TTSVPFGVGTGVGSY 369
            TTSVPFG G  VG+Y
Sbjct  140  TTSVPFG-GGAVGAY 153

Sequence Alignment: 39. Allergen Name: Tri a glutenin Sequence ID: CAA59313

 Score = 53.0 bits 396,  Expect = 5e-09
 Identities = 59/72 81%, Positives = 63/72 87%, Gaps = 1/72 1%
Query  7    FALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPC 66
            FAL+A+VATSAIAQME SHIP LE+P QQQPLP QQ L  +QQQQPIQQQPQPF QQ PC
Sbjct  1    FALIAVVATSAIAQMETSHIPSLEKPLQQQPLPLQQIL-WYQQQQPIQQQPQPFPQQPPC 59
Query  67   SQQQQQPLSQQQQ 79
            SQQQQ PLSQQQQ
Sbjct  60   SQQQQPPLSQQQQ 72

Sequence Alignment: 40. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 55.7 bits 421,  Expect = 7e-09
 Identities = 125/282 44%, Positives = 146/282 51%, Gaps = 52/282 18%
Query  30   ERPSQQQ----PLPPQQTLSHHQQQQPIQQQPQ------PFSQQQPCSQQQQQPLSQQQQ 79
            ++P Q Q    P  PQQ L + QQ +  QQ  Q      P S QQP   QQ + L+ QQQ
Sbjct  228  QQPGQWQQGYYPTSPQQ-LGQGQQPRQWQQSGQGQQGHYPTSLQQPGQGQQGHYLASQQQ 286
Query  80   P--------PFSQQQPPFSQQQQQPLSQQQ-------QPPFSQQQPPFSQQQQPPFSQQQ 124
            P        P SQQQP   QQ + P SQQQ       + P SQQ+P   QQ Q P SQQQ
Sbjct  287  PGQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQEPGQGQQGQIPASQQQ 346
Query  125  PPFSQQ-QQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPP 183
            P   QQ + P   QQP   QQ   P S QQ  + Q QQ     QP   Q+QQP   QQ  
Sbjct  347  PGQGQQGHYPASLQQPGQGQQGHYPTSLQQ--LGQGQQ---TGQPG--QKQQPGQGQQTG 399
Query  184  FSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVM 243
              QQ +Q   P Q     +P+ LQQ  P +   Q Q      P SL +    QQ      
Sbjct  400  QGQQPEQEQQPGQGQQGYYPTSLQQ--PGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPAS 457
Query  244  QQQCCQQLP---QIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQ 300
             QQ  Q  P   Q P Q ++            Q  Q  QG   T  QQP Q GQ + Q Q
Sbjct  458  LQQPGQGQPGQRQQPGQGQHPEQGK-------QPGQGQQGYYPTSPQQPGQ-GQQLGQGQ 509
Query  301  Q----QSQQQLGQQPQQQQLAQGTF-LQPHQIAQ 329
            Q     S QQ GQ  Q  Q  QG     P+Q  Q
Sbjct  510  QGYYPTSPQQPGQGQQPGQGQQGHCPTSPQQSGQ 543

Sequence Alignment: 41. Allergen Name: Tri a 26.0101 Sequence ID: P10388

 Score = 55.8 bits 422,  Expect = 8e-09
 Identities = 129/288 44%, Positives = 146/288 50%, Gaps = 60/288 20%
Query  20   QMENSHIP-GLERPSQ-QQPLPPQQTLSHHQQQQPIQQQP---------QPFSQQQPCSQ 68
            Q +  + P   ++P Q QQP   QQ    +Q QQP Q QP         QP   QQP   
Sbjct  163  QGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQGQPGYYPTSSQLQPGQLQQPAQG 222
Query  69   QQ-QQP-LSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQ---PPFSQQ 123
            QQ QQP  +QQ Q P   QQP   QQ QQP  Q QQP   QQ   + Q QQ   P   QQ
Sbjct  223  QQGQQPGQAQQGQQPGQGQQPGQGQQGQQP-GQGQQPGQGQQGQQLGQGQQGYYPTSLQQ 281
Query  124  ----QP---PFSQQQ--------QPVLPQQPSFSQQ--QLPPFSQQQSPFSQQQQIVLQQ 166
                QP   P S QQ         P  PQQP   QQ  QL   +Q Q P  Q QQ    Q
Sbjct  282  SGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQP-GQGQQ---GQ 337
Query  167  QPPFLQQ-QQPSLPQQPPFSQQQQQLVLPQQQ---IPFVHPSILQQLNPCKVFLQQQCSP 222
            QP   QQ QQP   QQP   Q       PQQ     P  +P+  QQ  P +    QQ   
Sbjct  338  QPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQ--PTQ---SQQPGQ 392
Query  223  VAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSI 282
                Q + + Q  QQ       QQ  Q  P     S  ++ +      +   QQ  QG  
Sbjct  393  GQQGQQVGQGQQAQQPG---QGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQG-- 447
Query  283  QTP---QQQPQ-QLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQ 326
            Q P   QQ  Q Q GQ   Q QQ  Q Q GQQP Q Q  Q    QP Q
Sbjct  448  QQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQ----QPGQ 491
 Score = 42.0 bits 286,  Expect = 0.0001
 Identities = 129/299 43%, Positives = 144/299 48%, Gaps = 59/299 19%
Query  27   PGLERPSQQQPLPPQQTLSHHQQQQPIQQQP--QPFSQQQPCSQQQ-QQPLSQQQ----Q 79
            PG    S QQ    QQ     Q QQP Q QP   P S  QP   Q    P S QQ    Q
Sbjct  494  PGYYPTSPQQSGQGQQP---GQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQ 550
Query  80   PPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQ-QQPPFSQQQPPFSQQQQPVLPQQ 138
             P   QQP   QQ QQ L+Q QQ     QQP   QQ QQP   QQ   + Q QQ    QQ
Sbjct  551  QPGQLQQPAQGQQGQQ-LAQGQQ----GQQPAQVQQGQQPAQGQQGQQLGQGQQG---QQ 602
Query  139  PSFSQQ-QLPPFSQQQSPFSQQQQIVLQQQPPFLQQ-QQPSLPQQPPFSQQQQQLVLPQQ 196
            P   QQ Q P   QQ     Q Q+    QQP   QQ QQP   QQP   Q       PQ+
Sbjct  603  PGQGQQGQQPAQGQQGQQPGQGQH---GQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQE 659
Query  197  QIPFVHPSILQQLNPCKVFLQQQCSPVA-------MPQSLARSQMLQQSSCHVMQQQCCQ 249
                 +P   QQ    +       S  A        P SL +    QQ       QQ  Q
Sbjct  660  SGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQQPGQGQQPG---QWQQSGQ 716
Query  250  ----QLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQT-PQQQPQ--QLGQCVSQPQQQ 302
                  P  P+ S  +  R   +   LQ  Q  QG   T PQQ PQ  QLGQ + QP Q 
Sbjct  717  GQHWYYPTSPKLSG-QGQRPGQW---LQPGQGQQGYYPTSPQQPPQGQQLGQWL-QPGQG 771
Query  303  SQ-------QQLGQQPQQQQLAQGTFLQ-----PHQIAQLEVMTSIALRT-LPTMCRV 347
             Q       QQ GQ  Q  Q  QG +        HQ A L+V  +  L   LP MCR+
Sbjct  772  QQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRL 829

Sequence Alignment: 42. Allergen Name: Tri a glutenin Sequence ID: CAA31395

 Score = 55.8 bits 422,  Expect = 8e-09
 Identities = 129/288 44%, Positives = 146/288 50%, Gaps = 60/288 20%
Query  20   QMENSHIP-GLERPSQ-QQPLPPQQTLSHHQQQQPIQQQP---------QPFSQQQPCSQ 68
            Q +  + P   ++P Q QQP   QQ    +Q QQP Q QP         QP   QQP   
Sbjct  163  QGQQGYYPTSPQQPGQLQQPAQGQQPGQGQQGQQPGQGQPGYYPTSSQLQPGQLQQPAQG 222
Query  69   QQ-QQP-LSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQ---PPFSQQ 123
            QQ QQP  +QQ Q P   QQP   QQ QQP  Q QQP   QQ   + Q QQ   P   QQ
Sbjct  223  QQGQQPGQAQQGQQPGQGQQPGQGQQGQQP-GQGQQPGQGQQGQQLGQGQQGYYPTSLQQ 281
Query  124  ----QP---PFSQQQ--------QPVLPQQPSFSQQ--QLPPFSQQQSPFSQQQQIVLQQ 166
                QP   P S QQ         P  PQQP   QQ  QL   +Q Q P  Q QQ    Q
Sbjct  282  SGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQP-GQGQQ---GQ 337
Query  167  QPPFLQQ-QQPSLPQQPPFSQQQQQLVLPQQQ---IPFVHPSILQQLNPCKVFLQQQCSP 222
            QP   QQ QQP   QQP   Q       PQQ     P  +P+  QQ  P +    QQ   
Sbjct  338  QPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQ--PTQ---SQQPGQ 392
Query  223  VAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSI 282
                Q + + Q  QQ       QQ  Q  P     S  ++ +      +   QQ  QG  
Sbjct  393  GQQGQQVGQGQQAQQPG---QGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQG-- 447
Query  283  QTP---QQQPQ-QLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQ 326
            Q P   QQ  Q Q GQ   Q QQ  Q Q GQQP Q Q  Q    QP Q
Sbjct  448  QQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQ----QPGQ 491
 Score = 42.0 bits 286,  Expect = 0.0001
 Identities = 129/299 43%, Positives = 144/299 48%, Gaps = 59/299 19%
Query  27   PGLERPSQQQPLPPQQTLSHHQQQQPIQQQP--QPFSQQQPCSQQQ-QQPLSQQQ----Q 79
            PG    S QQ    QQ     Q QQP Q QP   P S  QP   Q    P S QQ    Q
Sbjct  494  PGYYPTSPQQSGQGQQP---GQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQ 550
Query  80   PPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQ-QQPPFSQQQPPFSQQQQPVLPQQ 138
             P   QQP   QQ QQ L+Q QQ     QQP   QQ QQP   QQ   + Q QQ    QQ
Sbjct  551  QPGQLQQPAQGQQGQQ-LAQGQQ----GQQPAQVQQGQQPAQGQQGQQLGQGQQG---QQ 602
Query  139  PSFSQQ-QLPPFSQQQSPFSQQQQIVLQQQPPFLQQ-QQPSLPQQPPFSQQQQQLVLPQQ 196
            P   QQ Q P   QQ     Q Q+    QQP   QQ QQP   QQP   Q       PQ+
Sbjct  603  PGQGQQGQQPAQGQQGQQPGQGQH---GQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQE 659
Query  197  QIPFVHPSILQQLNPCKVFLQQQCSPVA-------MPQSLARSQMLQQSSCHVMQQQCCQ 249
                 +P   QQ    +       S  A        P SL +    QQ       QQ  Q
Sbjct  660  SGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSLQQPGQGQQPG---QWQQSGQ 716
Query  250  ----QLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQT-PQQQPQ--QLGQCVSQPQQQ 302
                  P  P+ S  +  R   +   LQ  Q  QG   T PQQ PQ  QLGQ + QP Q 
Sbjct  717  GQHWYYPTSPKLSG-QGQRPGQW---LQPGQGQQGYYPTSPQQPPQGQQLGQWL-QPGQG 771
Query  303  SQ-------QQLGQQPQQQQLAQGTFLQ-----PHQIAQLEVMTSIALRT-LPTMCRV 347
             Q       QQ GQ  Q  Q  QG +        HQ A L+V  +  L   LP MCR+
Sbjct  772  QQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRL 829

Sequence Alignment: 43. Allergen Name: Tri a glutenin Sequence ID: CAA27052

 Score = 54.9 bits 413,  Expect = 2e-08
 Identities = 126/281 44%, Positives = 140/281 49%, Gaps = 54/281 19%
Query  27   PG-LERPSQ-QQPLPPQQTLSHHQQQQ---PIQQQPQPFSQQQPCSQQQ-QQP-LSQQQQ 79
            PG L++P+Q QQP   QQ     Q Q    P   Q QP   QQP   QQ QQP   QQ Q
Sbjct  181  PGQLQQPAQGQQPGQGQQGRQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQ 240
Query  80   PPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQ---PPFSQQ----QP---PFSQ 129
             P   QQP   QQ QQP  Q QQP   QQ   + Q QQ   P   QQ    QP   P S 
Sbjct  241  QPGQGQQPGQGQQGQQP-GQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSL 299
Query  130  QQ--------QPVLPQQPSFSQQ--QLPPFSQQQSPFSQQQQIVLQQQPPFLQQ-QQPSL 178
            QQ         P  PQQP   QQ  QL   +Q Q P   QQ     QQP   QQ QQP  
Sbjct  300  QQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQG----QQPGQGQQGQQPGQ 355
Query  179  PQQPPFSQQQQQLVLPQQQ---IPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQML 235
             QQP   Q       PQQ     P  +P+  QQ  P +    QQ       Q + + Q  
Sbjct  356  GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQ--PTQ---SQQPGQGQQGQQVGQGQQA 410
Query  236  QQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTP---QQQPQ-Q 291
            QQ       QQ  Q  P     S  ++ +      +   QQ  QG  Q P   QQ  Q Q
Sbjct  411  QQPG---QGQQPGQGQPGYYPTSPLQSGQGQPGYYLTSPQQSGQG--QQPGQLQQSAQGQ 465
Query  292  LGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQ 326
             GQ   Q QQ  Q Q GQQP Q Q  Q    QP Q
Sbjct  466  KGQQPGQGQQPGQGQQGQQPGQGQQGQ----QPGQ 496
 Score = 48.8 bits 353,  Expect = 1e-06
 Identities = 127/287 44%, Positives = 141/287 49%, Gaps = 64/287 22%
Query  20   QMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQPQPFSQQQPCSQQQQQPLSQQQQ 79
            Q      PG    S  QP   Q        QQP Q Q QP   QQP   QQ Q L+Q QQ
Sbjct  519  QQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQ-QPGQLQQPAQGQQGQQLAQGQQ 577
Query  80   PPFSQQQPPFSQQQQQPLSQQQQPPFSQ----QQPPFSQQQQPPFSQQ--QPPFSQQ-QQ 132
                 QQP   QQ QQP   QQ   + Q    QQP   Q QQP   QQ  QP   QQ QQ
Sbjct  578  G----QQPAQVQQGQQPAQGQQGQQLGQGQQGQQP--GQGQQPAQGQQGQQPGQGQQGQQ 631
Query  133  PVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLV 192
            P   QQP   Q    P S Q+S   Q QQ    QQP   Q QQP   Q  P       L 
Sbjct  632  PGQGQQPGQGQPWYYPTSPQES--GQGQQPGQWQQPG--QWQQPG--QGQPGYYLTSPLQ 685
Query  193  LPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLP 252
            L Q Q  + +P+ LQQ                 P    +    QQS      Q      P
Sbjct  686  LGQGQQGY-YPTSLQQ-----------------PGQGQQPGQWQQSG-----QGQHGYYP 722
Query  253  QIPQQSRYEAIRAIIYSIILQEQQQVQGSIQT-PQQ--QPQQLGQCVSQPQQQSQ----- 304
              PQ S  +  R   +   LQ  Q  QG   T PQQ  Q QQLGQ + QP Q  Q     
Sbjct  723  TSPQLSG-QGQRPGQW---LQPGQGQQGYYPTSPQQSGQGQQLGQWL-QPGQGQQGYYPT 777
Query  305  --QQLGQQPQQQQLAQGTFLQ-----PHQIAQLEVMTSIALRT-LPTMCRV 347
              QQ GQ  Q  Q  QG +        HQ A L+V  +  L   LP MCR+
Sbjct  778  SLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRL 828

Sequence Alignment: 44. Allergen Name: Tri a glutenin Sequence ID: CAA43361

 Score = 53.7 bits 402,  Expect = 3e-08
 Identities = 120/294 40%, Positives = 143/294 48%, Gaps = 46/294 15%
Query  18   IAQMENSHIP-GLERPSQQQPLPPQQ-----TLSHH--QQQQPIQQQP----QPFSQQQP 65
            I Q +  + P  L++P Q Q +   Q     T  +H  Q+QQP Q Q     Q + Q + 
Sbjct  197  IGQGQQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQIGQGQQLGQGRQ 256
Query  66   CSQQQQQPLSQQQQPPFSQQQPPFSQQ----QQQPLSQQQQPPFSQQQPPFSQQQQPPFS 121
              Q QQ    QQ   P S QQ    QQ    QQ    QQ   P SQQQP   QQ Q P S
Sbjct  257  IGQGQQSGQGQQGYYPTSPQQLGQGQQPGQWQQSGQGQQGYYPTSQQQPGQGQQGQYPAS 316
Query  122  QQQPPFSQQ-QQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQ--PSL 178
            QQQP   QQ Q P   QQP   QQ   P SQQQ    QQ + +  QQ P   QQ+  P+ 
Sbjct  317  QQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGHYLASQQQPGQGQQRHYPAS 376
Query  179  PQQPPFSQQQQ---QLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQML 235
             QQP   QQ +    L  P Q     +P+ LQQ+        QQ   +   Q   + Q  
Sbjct  377  LQQPGQGQQGHYTASLQQPGQGQQGHYPASLQQVGQ-----GQQIGQLGQRQQPGQGQQT 431
Query  236  QQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQC 295
            +Q      QQ    Q P   QQ+R           + Q QQ  QG        PQQ GQ 
Sbjct  432  RQG-----QQLEQGQQPGQGQQTRQG-------QQLEQGQQPGQGQQGYYPTSPQQSGQG 479
Query  296  VSQPQQQSQQQLGQQ----PQQQQLAQGTFLQPHQIAQLE 331
              QP Q  Q   GQQ       QQ  QG  LQ H  A L+
Sbjct  480  -QQPGQSQQPGQGQQGYYSSSLQQPGQG--LQGHYPASLQ 516

Sequence Alignment: 45. Allergen Name: Tri a 21.0101 Sequence ID: CAY54134

 Score = 52.1 bits 386,  Expect = 4e-08
 Identities = 136/257 52%, Positives = 169/257 65%, Gaps = 48/257 18%
Query  73   PLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQ 132
            P  Q Q P  SQQQP    Q+Q PL QQQQ  + QQQ  F  QQQP F  QQP    Q Q
Sbjct  6    PQLQPQNP--SQQQP----QEQVPLVQQQQF-LGQQQQHFPGQQQP-FPPQQP--YPQPQ 55
Query  133  PVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLV 192
            P LPQ P    Q +PP  QQ  P         Q QP + Q QQP   QQ  + QQQQQ  
Sbjct  56   PFLPQLPYPQPQPFPP--QQSYP---------QPQPQYPQPQQPISQQQAQLQQQQQQ-- 102
Query  193  LPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQL 251
              QQQI  ++  + QQL PC+ V LQQ       P     S  + Q S +++QQ CCQQL
Sbjct  103  -QQQQI--LQQILQQQLIPCRDVVLQQ-------PNIAHASSQVSQQSYQLLQQLCCQQL 152
Query  252  PQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLG-QQ 310
             Q P+QSR +AI  +I++IIL+ QQQ Q   Q  QQQ QQ  Q   Q QQQ   Q+  QQ
Sbjct  153  WQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQ 212
Query  311  PQQQQLA-QGTF------------LQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
            PQQQ  + QG+F            +QP+Q+ Q+E + ++AL+TLP MC V +P Y +TT 
Sbjct  213  PQQQYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTI 272
Query  358  VPFGV 362
             PFG+
Sbjct  273  APFGI 277

Sequence Alignment: 46. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 51.2 bits 377,  Expect = 2e-07
 Identities = 126/305 41%, Positives = 141/305 46%, Gaps = 36/305 11%
Query  29   LERPSQ-QQPLPPQQTLSHHQQQQPIQQQP--QPFSQQQPCSQQQ--QQPLSQQQQP--- 80
            L++P+Q QQP   QQ     Q QQP Q QP   P S QQ   +QQ  Q   S Q QP   
Sbjct  479  LQQPAQGQQPGQEQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHY 538
Query  81   PFSQQQPPFSQQQQQPLSQQQ----QPPFSQQQPPFSQQ-QQPPFSQQ--QPPFSQQ-QQ 132
            P S  QP   Q    P S QQ    Q P   QQP   QQ QQP   QQ  QP   QQ QQ
Sbjct  539  PTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGEGQQGQQ 598
Query  133  PVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSL-PQQPPFSQQQQQL 191
            P   QQP   Q    P S QQS   Q QQ    QQP    Q QP   P      +Q QQ 
Sbjct  599  PGQGQQPGQGQPGYYPTSLQQS--GQGQQPGQWQQPG---QGQPGYYPTSSLQPEQGQQG 653
Query  192  VLP-QQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQ 250
              P  QQ P   P   Q     +   QQ   P + PQ   + Q   Q        Q    
Sbjct  654  YYPTSQQQPGQGPQPGQWQQSGQG--QQGYYPTS-PQQSGQGQQPGQWLQPGQWLQSGYY 710
Query  251  LPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQT-PQQ--QPQQLGQCVSQPQQQSQQQL 307
            L    Q  + +  R       LQ +Q  QG   T PQQ  Q QQLGQ        S QQ 
Sbjct  711  LTSPQQLGQGQQPRQW-----LQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQS 765
Query  308  GQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRT-LPTMCRV 347
            GQ  QQ   +       HQ A L+V  +  L   LP MCR+
Sbjct  766  GQG-QQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRL 805
 Score = 49.7 bits 362,  Expect = 5e-07
 Identities = 120/313 38%, Positives = 141/313 45%, Gaps = 39/313 12%
Query  6    IFALLAIVATSAIAQMENSHIPGLERPSQQQPLPPQQT--LSHHQQQQPIQQQPQPFSQQ 63
            I ALL     S  +  + S+ PG  + S Q+P   QQ   L+  QQ    QQ  Q  S  
Sbjct  102  IPALLRRYYLSVTSPQQVSYYPG--QASSQRPGQGQQEYYLTSPQQSGQWQQPGQGQSGY 159
Query  64   QPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLS-QQQQPPFSQQQPPFSQQQQPPFSQ 122
             P S QQ    S Q+QP +    P   +Q QQP   QQ+Q P   QQ    QQ Q    Q
Sbjct  160  YPTSPQQ----SGQKQPGYYPTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQS-GQ 214
Query  123  QQP---PFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQ--PPFLQQQQPS 177
             QP   P S QQ   L Q     Q Q P   QQ     Q QQ+   QQ   P  Q+QQ  
Sbjct  215  GQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPG-QKQQSG 273
Query  178  LPQQPPFSQQQQQLVLPQQ----QIPFVHPSILQQLN-------PCKVFLQQQCSPVAMP 226
              QQ  +    QQL   QQ    Q+ + +P+  QQ         P       Q       
Sbjct  274  QGQQGYYPISPQQLGQGQQSGQGQLGY-YPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQE 332
Query  227  QSLARSQMLQQSSCHVMQQQCCQ-QLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTP 285
            Q L + Q  QQS      QQ  Q Q  Q   Q +    R   Y      QQ  QG  +  
Sbjct  333  QQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGY-YSTSPQQLGQGQPRYY 391
Query  286  QQQPQQLGQCVSQP---QQQSQQQLGQQPQQ----QQLAQGTF-LQPHQIAQ 329
               PQQ GQ   QP   QQ  Q Q GQQP+Q    QQ  QG    QP Q  Q
Sbjct  392  PTSPQQPGQE-QQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQGQQ 442

Sequence Alignment: 47. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 50.9 bits 374,  Expect = 2e-07
 Identities = 127/318 39%, Positives = 144/318 45%, Gaps = 36/318 11%
Query  15   TSAIAQMENSHIPGLERPSQQQPLPPQQTLSHHQQQQPIQQQP--QPFSQQQPCSQQQ-- 70
            +  + Q    + PG E+  QQ P   QQ     Q QQP Q QP   P S QQ   +QQ  
Sbjct  482  SGQLQQPAQGQQPGQEQQGQQ-PGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLE 540
Query  71   QQPLSQQQQP---PFSQQQPPFSQQQQQPLSQQQ----QPPFSQQQPPFSQQ-QQPPFSQ 122
            Q   S Q QP   P S  QP   Q    P S QQ    Q P   QQP   QQ QQP   Q
Sbjct  541  QWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ 600
Query  123  Q--QPPFSQQ-QQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP-PFLQQQQPSL 178
            Q  QP   QQ QQP   QQP   Q    P S QQS   Q QQ    QQP   L    P+ 
Sbjct  601  QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQS--GQGQQPGQWQQPGQGLPGYYPTS 658
Query  179  PQQPPFSQQQQQLVLP-QQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQ 237
              QP   +Q QQ   P  QQ P   P   Q     +   QQ   P + PQ   + Q   Q
Sbjct  659  SLQP---EQGQQGYYPTSQQQPGQGPQPGQWQQSGQ--GQQGYYPTS-PQQSGQGQQPGQ 712
Query  238  SSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQT-PQQ--QPQQLGQ 294
                    Q    L    Q  + +  R       LQ +Q  QG   T PQQ  Q QQLGQ
Sbjct  713  WLQPGQWLQSGYYLTSPQQLGQGQQPRQW-----LQPRQGQQGYYPTSPQQSGQGQQLGQ 767
Query  295  CVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRT-LPTMCRV 347
                    S QQ GQ  QQ   +       HQ A L+V  +  L   LP MCR+
Sbjct  768  GQQGYYPTSPQQSGQG-QQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRL 820
 Score = 49.4 bits 359,  Expect = 7e-07
 Identities = 120/311 38%, Positives = 141/311 45%, Gaps = 40/311 12%
Query  6    IFALLAIVATSAIAQMENSHIPGL---ERPSQ-QQPLPPQQT--LSHHQQQQPIQQQPQP 59
            I ALL     S  +  + S+ PG    +RP Q QQP   QQ   L+  QQ    QQ  Q 
Sbjct  102  IPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQQSGQWQQPGQG 161
Query  60   FSQQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLS-QQQQPPFSQQQPPFSQQQQP 118
             +   P S QQ    S Q+QP +    P   +Q QQP   QQ+Q P   QQ    QQ Q 
Sbjct  162  QAGYYPTSPQQ----SGQEQPGYYPTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQ 217
Query  119  PFSQQQP---PFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQ--PPFLQQ 173
               Q QP   P S QQ   L Q     Q Q P   QQ     Q QQ+   QQ   P  Q+
Sbjct  218  S-GQGQPRYYPTSSQQPGQLQQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPG-QK 275
Query  174  QQPSLPQQPPFSQQQQQLVLPQQ----QIPFVHPSILQQLN-------PCKVFLQQQCSP 222
            QQ    QQ  +    QQL   QQ    Q+ + +P+  QQ         P       Q   
Sbjct  276  QQSGQGQQGYYPISPQQLGQGQQSGQGQLGY-YPTSPQQSGQGQSGYYPTSAQQPGQLQQ 334
Query  223  VAMPQSLARSQMLQQSSCHVMQQQCCQ-QLPQIPQQSRYEAIRAIIYSIILQEQQQVQGS 281
                Q L + Q  QQS      QQ  Q Q  Q   Q +    R   Y      QQ  QG 
Sbjct  335  STQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGY-YSTSPQQLGQGQ 393
Query  282  IQTPQQQPQQLGQCVSQP---QQQSQQQLGQQPQQQQLAQGTFLQPHQIAQ 329
             +     PQQ GQ   QP   QQ  Q Q GQQP+Q Q  Q    QP Q  Q
Sbjct  394  PRYYPTSPQQPGQE-QQPRQLQQPEQGQQGQQPEQGQQGQ----QPGQGEQ 439

Sequence Alignment: 48. Allergen Name: Tri a glutenin Sequence ID: Q9S8D7

 Score = 36.1 bits 230,  Expect = 0.0002
 Identities = 30/30 100%, Positives = 30/30 100%, Gaps = 0/30 0%
Query  98   SQQQQPPFSQQQPPFSQQQQPPFSQQQPPF 127
            SQQQQPPFSQQQPPFSQQQQPPFSQQQPPF
Sbjct  1    SQQQQPPFSQQQPPFSQQQQPPFSQQQPPF 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.